NR2E3 monoclonal antibody (M01), clone 2A12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of NR2E3 expression in transfected 293T cell line by NR2E3 monoclonal antibody (M01), clone 2A12.
Lane 1: NR2E3 transfected lysate(44.7 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NR2E3 is approximately 0.3ng/ml as a capture antibody.
Western Blot detection against Immunogen (61.16 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant NR2E3.
Immunogen
NR2E3 (AAH41421, 1 a.a. ~ 322 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MCPVDKAHRNQCQACRLKKCLQAGMNQDAVQNERQPRSTAQVHLDSMESNTESRPESLVAPPAPAGRSPRGPTPMSAARALGHHFMASLITAETCAKLEPEDADENIDVTSNDPEFPSSPYSSSSPCGLDSIHETSARLLFMAVKWAKNLPVFSSLPFRDQVILLEEAWSELFLLGAIQWSLPLDSCPLLAPPEASAAGGAQGRLTLASMETRVLQETISRFRALAVDPTEFACMKALVLFKPETRGLKDPEHVEALQDQSQVMLSQHSKAHHPSQPVRFGKLLLLLPSLRFITAERIELLFFRKTIGNTPMEKLLCDMFKN
Host
Mouse
Reactivity
Human
Isotype
IgG1
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (61.16 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of NR2E3 expression in transfected 293T cell line by NR2E3 monoclonal antibody (M01), clone 2A12.
Lane 1: NR2E3 transfected lysate(44.7 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NR2E3 is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — NR2E3
Entrez GeneID
10002GeneBank Accession#
BC041421Protein Accession#
AAH41421Gene Name
NR2E3
Gene Alias
ESCS, MGC49976, PNR, RNR, RP37, rd7
Gene Description
nuclear receptor subfamily 2, group E, member 3
Gene Ontology
HyperlinkGene Summary
This protein is part of a large family of nuclear receptor transcription factors involved in signaling pathways. Nuclear receptors have been shown to regulate pathways involved in embryonic development, as well as in maintenance of proper cell function in adults. Members of this family are characterized by discrete domains that function in DNA and ligand binding. This gene encodes a retinal nuclear receptor that is a ligand-dependent transcription factor. Defects in this gene are a cause of enhanced S cone syndrome. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq
Other Designations
photoreceptor-specific nuclear receptor|retina-specific nuclear receptor
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com