SPAG6 monoclonal antibody (M01), clone 3E3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
SPAG6 monoclonal antibody (M01), clone 3E3 Western Blot analysis of SPAG6 expression in A-431 ( Cat # L015V1 ).
Western Blot detection against Immunogen (37.11 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SPAG6.
Immunogen
SPAG6 (NP_036575, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MSQRQVLQVFEQYQKARTQFVQMVAELATRPQNIETLQNAGVMSLLRTLLLDVVPTIQQTAALALGRLANYNDDLAEAVVKCDILPQLVYSLAEQNRFYK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (96); Rat (95)
Isotype
IgG3 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.11 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
SPAG6 monoclonal antibody (M01), clone 3E3 Western Blot analysis of SPAG6 expression in A-431 ( Cat # L015V1 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — SPAG6
Entrez GeneID
9576GeneBank Accession#
NM_012443Protein Accession#
NP_036575Gene Name
SPAG6
Gene Alias
DKFZp434I153, MGC26276, Repro-SA-1, pf16
Gene Description
sperm associated antigen 6
Omim ID
605730Gene Ontology
HyperlinkGene Summary
The correlation of anti-sperm antibodies with cases of unexplained infertility implicates a role for these antibodies in blocking fertilization. Improved diagnosis and treatment of immunologic infertility, as well as identification of proteins for targeted contraception, are dependent on the identification and characterization of relevant sperm antigens. The protein expressed by this gene is recognized by anti-sperm antibodies from an infertile man. This protein localizes to the tail of permeabilized human sperm and contains eight contiguous armadillo repeats, a motif known to mediate protein-protein interactions. Studies in mice suggest that this protein is involved in sperm flagellar motility and maintenance of the structural integrity of mature sperm. Alternatively spliced variants that encode different protein isoforms have been described but the full-length sequences of only two have been determined. [provided by RefSeq
Other Designations
OTTHUMP00000019296|OTTHUMP00000019297|axoneme central apparatus protein|sperm flagellar protein
-
Interactome
-
Disease
-
Publication Reference
-
CCDC176 stabilizes microtubule doublets 1 and 9 to ensure proper sperm movement.
Chao Liu, Qianchun Wang, Lusheng Gu, Xiuge Wang, Yingying Yin, Tao Huang, Sai Xiao, Shuwen Zhang, Fuqiang Wang, Tao Zhou, Guangqiong Xu, Liying Wang, Fucheng Dong, Jing Jiang, Mengcheng Luo, Jinsong Li, Haobo Zhang, Zi-Jiang Chen, Wei Ji, Baohua Ji, Hongbin Liu, Wei Li.
Current Biology : CB 2023 Jul; 33(16):3371.
Application：IF, WB-Ti, Mouse, Mouse spermatozoa.
-
CCDC176 stabilizes microtubule doublets 1 and 9 to ensure proper sperm movement.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com