HAND2 monoclonal antibody (M06), clone 3D5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant HAND2.
Immunogen
HAND2 (NP_068808.1, 135 a.a. ~ 216 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LSKIKTLRLATSYIAYLMDLLAKDDQNGEAEAFKAEIKKTDVKEEKRKKELNEILKSTVSSNDKKTKGRTGWPQHVWALELK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (100); Rat (100)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (34.76 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of HAND2 expression in transfected 293T cell line by HAND2 monoclonal antibody (M06), clone 3D5.
Lane 1: HAND2 transfected lysate(21.6 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of HAND2 over-expressed 293 cell line, cotransfected with HAND2 Validated Chimera RNAi ( Cat # H00009464-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with HAND2 monoclonal antibody (M06), clone 3D5 (Cat # H00009464-M06 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — HAND2
Entrez GeneID
9464GeneBank Accession#
NM_021973Protein Accession#
NP_068808.1Gene Name
HAND2
Gene Alias
DHAND2, FLJ16260, Hed, MGC125303, MGC125304, Thing2, bHLHa26, dHand
Gene Description
heart and neural crest derivatives expressed 2
Omim ID
602407Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene belongs to the basic helix-loop-helix family of transcription factors. This gene product is one of two closely related family members, the HAND proteins, which are asymmetrically expressed in the developing ventricular chambers and play an essential role in cardiac morphogenesis. Working in a complementary fashion, they function in the formation of the right ventricle and aortic arch arteries, implicating them as mediators of congenital heart disease. In addition, this transcription factor plays an important role in limb and branchial arch development. [provided by RefSeq
Other Designations
basic helix-loop-helix transcription factor HAND2
-
Interactome
-
Disease
-
Publication Reference
-
Progestin-induced heart and neural crest derivatives expressed transcript 2 is associated with fibulin-1 expression in human endometrial stromal cells.
Cho H, Okada H, Tsuzuki T, Nishigaki A, Yasuda K, Kanzaki H.
Fertility and Sterility 2013 Jan; 99(1):248.
Application:WB-Tr, Human, Human endometrial stromal cells.
-
Progestin-induced heart and neural crest derivatives expressed transcript 2 is associated with fibulin-1 expression in human endometrial stromal cells.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com