PRKCABP monoclonal antibody (M01), clone 3G5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
PRKCABP monoclonal antibody (M01), clone 3G5. Western Blot analysis of PICK1 expression in rat brain.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PICK1 is 0.3 ng/ml as a capture antibody.
Western Blot detection against Immunogen (37.84 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PRKCABP.
Immunogen
PRKCABP (NP_036539, 266 a.a. ~ 375 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
KVKEMDDEEYSCIALGEPLYRVSTGNYEYRLILRCRQEARARFSQMRKDVLEKMELLDQKHVQDIVFQLQRLVSTMSKYYNDCYAVLRDADVFPIEVDLAHTTLAYGLNQ
Host
Mouse
Reactivity
Human, Rat
Interspecies Antigen Sequence
Mouse (96); Rat (97)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
PRKCABP monoclonal antibody (M01), clone 3G5. Western Blot analysis of PICK1 expression in rat brain.Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PICK1 is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — PICK1
Entrez GeneID
9463GeneBank Accession#
NM_012407Protein Accession#
NP_036539Gene Name
PICK1
Gene Alias
MGC15204, PICK, PRKCABP
Gene Description
protein interacting with PRKCA 1
Omim ID
605926Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene contains a PDZ domain, through which it interacts with protein kinase C, alpha (PRKCA). This protein may function as an adaptor that binds to and organizes the subcellular localization of a variety of membrane proteins. It has been shown to interact with multiple glutamate receptor subtypes, monoamine plasma membrane transporters, as well as non-voltage gated sodium channels, and may target PRKCA to these membrane proteins and thus regulate their distribution and function. This protein has also been found to act as an anchoring protein that specifically targets PRKCA to mitochondria in a ligand-specific manner. Three transcript variants encoding the same protein have been found for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000028509|PRKCA-binding protein|protein interacting with C kinase 1|protein kinase C, alpha binding protein
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com