GSTO1 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
GSTO1 MaxPab polyclonal antibody. Western Blot analysis of GSTO1 expression in NIH/3T3.
Western Blot (Cell lysate)
GSTO1 MaxPab polyclonal antibody. Western Blot analysis of GSTO1 expression in Jurkat.
Western Blot (Cell lysate)
GSTO1 MaxPab polyclonal antibody. Western Blot analysis of GSTO1 expression in PC-12.
Western Blot (Cell lysate)
GSTO1 MaxPab polyclonal antibody. Western Blot analysis of GSTO1 expression in HeLa.
Western Blot (Transfected lysate)
Western Blot analysis of GSTO1 expression in transfected 293T cell line (H00009446-T01) by GSTO1 MaxPab polyclonal antibody.
Lane 1: GSTO1 transfected lysate(26.51 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to GSTO1 on HeLa cell. [antibody concentration 10 ug/ml]
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human GSTO1 protein.
Immunogen
GSTO1 (NP_004823.1, 1 a.a. ~ 241 a.a) full-length human protein.
Sequence
MSGESARSLGKGSAPPGPVPEGSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKNKPEWFFKKNPFGLVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMILELFSKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMAAMKEDPTVSALLTSEKDWQGFLELYLQNSPEACDYGL
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (72); Rat (77)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
GSTO1 MaxPab polyclonal antibody. Western Blot analysis of GSTO1 expression in NIH/3T3.Western Blot (Cell lysate)
GSTO1 MaxPab polyclonal antibody. Western Blot analysis of GSTO1 expression in Jurkat.Western Blot (Cell lysate)
GSTO1 MaxPab polyclonal antibody. Western Blot analysis of GSTO1 expression in PC-12.Western Blot (Cell lysate)
GSTO1 MaxPab polyclonal antibody. Western Blot analysis of GSTO1 expression in HeLa.Western Blot (Transfected lysate)
Western Blot analysis of GSTO1 expression in transfected 293T cell line (H00009446-T01) by GSTO1 MaxPab polyclonal antibody.
Lane 1: GSTO1 transfected lysate(26.51 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to GSTO1 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — GSTO1
Entrez GeneID
9446GeneBank Accession#
NM_004832.1Protein Accession#
NP_004823.1Gene Name
GSTO1
Gene Alias
DKFZp686H13163, GSTTLp28, P28
Gene Description
glutathione S-transferase omega 1
Omim ID
605482Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the theta class glutathione S-transferase-like (GSTTL) protein family. In mouse, the encoded protein acts as a small stress response protein, likely involved in cellular redox homeostasis. [provided by RefSeq
Other Designations
OTTHUMP00000020429|glutathione S-transferase omega 1-1|glutathione transferase omega 1|glutathione-S-transferase like|glutathione-S-transferase omega 1
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Therapeutic modulation of GSTO activity rescues FUS-associated neurotoxicity via deglutathionylation in ALS disease models.
Sun Joo Cha, Seongsoo Lee, Hyun-Jun Choi, Yeo Jeong Han, Yu-Mi Jeon, Myungjin Jo, Shinrye Lee, Minyeop Nahm, Su Min Lim, Seung Hyun Kim, Hyung-Jun Kim, Kiyoung Kim.
Developmental Cell 2022 Mar; 57(6):783.
Application：WB-Tr, Mouse, N2a cells.
-
Therapeutic modulation of GSTO activity rescues FUS-associated neurotoxicity via deglutathionylation in ALS disease models.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com