GSTO1 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant GSTO1.
Immunogen
GSTO1 (NP_004823, 121 a.a. ~ 209 a.a) partial recombinant protein with GST tag.
Sequence
SKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMAAMKED
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (72); Rat (77)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.9 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
GSTO1 polyclonal antibody (A01), Lot # 051214JC01 Western Blot analysis of GSTO1 expression in HepG2 ( Cat # L019V1 ).Western Blot (Transfected lysate)
Western Blot analysis of GSTO1 expression in transfected 293T cell line by GSTO1 polyclonal antibody (A01).
Lane1:GSTO1 transfected lysate(27.566 KDa).
Lane2:Non-transfected lysate.
Western Blot (Recombinant protein)
ELISA
-
Gene Info — GSTO1
Entrez GeneID
9446GeneBank Accession#
NM_004832Protein Accession#
NP_004823Gene Name
GSTO1
Gene Alias
DKFZp686H13163, GSTTLp28, P28
Gene Description
glutathione S-transferase omega 1
Omim ID
605482Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the theta class glutathione S-transferase-like (GSTTL) protein family. In mouse, the encoded protein acts as a small stress response protein, likely involved in cellular redox homeostasis. [provided by RefSeq
Other Designations
OTTHUMP00000020429|glutathione S-transferase omega 1-1|glutathione transferase omega 1|glutathione-S-transferase like|glutathione-S-transferase omega 1
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
The functional landscape of Hsp27 reveals new cellular processes such as DNA repair and alternative splicing and proposes novel anticancer targets.
Katsogiannou M, Andrieu C, Baylot V, Baudot A, Dusetti NJ, Gayet O, Finetti P, Garrido C, Birnbaum D, Bertucci F, Brun C, Rocchi P.
Molecular & Cellular Proteomics 2014 Dec; 13(12):3585.
Application:WB-Ce, Human, PC-3 cells.
-
Identification of platinum-resistance associated proteins through proteomic analysis of human ovarian cancer cells and their platinum-resistant sublines.
Yan XD, Pan LY, Yuan Y, Lang JH, Mao N.
Journal of Proteome Research 2006 Dec; 6(2):772.
Application:WB, Human, A2780, SKOV3.
-
The functional landscape of Hsp27 reveals new cellular processes such as DNA repair and alternative splicing and proposes novel anticancer targets.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com