MED7 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human MED7 protein.
Immunogen
MED7 (NP_004261.1, 1 a.a. ~ 233 a.a) full-length human protein.
Sequence
MGEPQQVSALPPPPMQYIKEYTDENIQEGLAPKPPPPIKDSYMMFGNQFQCDDLIIRPLESQGIERLHPMQFDHKKELRKLNMSILINFLDLLDILIRSPGSIKREEKLEDLKLLFVHVHHLINEYRPHQARETLRVMMEVQKRQRLETAERFQKHLERVIEMIQNCLASLPDDLPHSEAGMRVKTEPMDADDSNNCTGQNEHQRENSGHRRDQIIEKDAALCVLIDEMNERP
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (96); Rat (97)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of MED7 expression in transfected 293T cell line (H00009443-T01) by MED7 MaxPab polyclonal antibody.
Lane 1: CRSP9 transfected lysate(25.63 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — MED7
Entrez GeneID
9443GeneBank Accession#
NM_004270.3Protein Accession#
NP_004261.1Gene Name
MED7
Gene Alias
CRSP33, CRSP9, MGC12284
Gene Description
mediator complex subunit 7
Omim ID
605045Gene Ontology
HyperlinkGene Summary
The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000160735|cofactor required for Sp1 transcriptional activation, subunit 9 (33kD)|cofactor required for Sp1 transcriptional activation, subunit 9, 33kDa
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com