UBE4A monoclonal antibody (M08), clone 1G8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant UBE4A.
Immunogen
UBE4A (NP_004779, 974 a.a. ~ 1073 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LAERIKSLADLQQQEEETYADACDEFLDPIMSTLMCDPVVLPSSRVTVDRSTIARHLLSDQTDPFNRSPLTMDQIRPNTELKEKIQRWLAERKQQKEQLE
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (98); Rat (98)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
UBE4A monoclonal antibody (M08), clone 1G8. Western Blot analysis of UBE4A expression in NIH/3T3.Western Blot (Cell lysate)
UBE4A monoclonal antibody (M08), clone 1G8. Western Blot analysis of UBE4A expression in PC-12.Western Blot (Cell lysate)
UBE4A monoclonal antibody (M08), clone 1G8. Western Blot analysis of UBE4A expression in K-562.Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged UBE4A is approximately 3ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to UBE4A on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — UBE4A
Entrez GeneID
9354GeneBank Accession#
NM_004788Protein Accession#
NP_004779Gene Name
UBE4A
Gene Alias
E4, KIAA0126, MGC133315, UBOX2, UFD2
Gene Description
ubiquitination factor E4A (UFD2 homolog, yeast)
Omim ID
603753Gene Ontology
HyperlinkGene Summary
The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes an additional conjugation factor, E4, which is involved in multiubiquitin chain assembly. [provided by RefSeq
Other Designations
homologous to yeast UFD2|ubiquitin conjugation factor E4 A|ubiquitination factor E4A|ubiquitination factor E4A (homologous to yeast UFD2)
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com