DYRK1B monoclonal antibody (M10), clone 2E8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of DYRK1B expression in transfected 293T cell line by DYRK1B monoclonal antibody (M10), clone 2E8.
Lane 1: DYRK1B transfected lysate (Predicted MW: 69.2 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged DYRK1B is 0.03 ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to DYRK1B on HeLa cell . [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (35.64 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant DYRK1B.
Immunogen
DYRK1B (AAH25291, 479 a.a. ~ 569 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
DNRTYRYSNRYCGGPGPPITDCEMNSPQVPPSQPLRPWAGGDVPHKTHQAPASASSLPGTGAQLPPQPRYLGRPPSPTSPPPPELMDVSLV
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (97); Rat (91)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.64 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of DYRK1B expression in transfected 293T cell line by DYRK1B monoclonal antibody (M10), clone 2E8.
Lane 1: DYRK1B transfected lysate (Predicted MW: 69.2 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged DYRK1B is 0.03 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to DYRK1B on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — DYRK1B
Entrez GeneID
9149GeneBank Accession#
BC025291Protein Accession#
AAH25291Gene Name
DYRK1B
Gene Alias
MIRK
Gene Description
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1B
Omim ID
604556Gene Ontology
HyperlinkGene Summary
DYRK1B is a member of the DYRK family of protein kinases. DYRK1B contains a bipartite nuclear localization signal and is found mainly in muscle and testis. The protein is proposed to be involved in the regulation of nuclear functions. Three isoforms of DYRK1B have been identified differing in the presence of two alternatively spliced exons within the catalytic domain. [provided by RefSeq
Other Designations
minibrain-related kinase
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com