ATP6V0D1 monoclonal antibody (M01), clone 2G12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ATP6V0D1.
Immunogen
ATP6V0D1 (NP_004682, 238 a.a. ~ 308 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
AKLFPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEGAGSNPGDKTLEDRFFEHEVKLNKLAFLN
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (33.55 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
ATP6V0D1 monoclonal antibody (M01), clone 2G12 Western Blot analysis of ATP6V0D1 expression in HeLa ( Cat # L013V1 ).Western Blot (Transfected lysate)
Western Blot analysis of ATP6V0D1 expression in transfected 293T cell line by ATP6V0D1 monoclonal antibody (M01), clone 2G12.
Lane 1: ATP6V0D1 transfected lysate(40.3 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to ATP6V0D1 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 0.5 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ATP6V0D1 is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — ATP6V0D1
Entrez GeneID
9114GeneBank Accession#
NM_004691Protein Accession#
NP_004682Gene Name
ATP6V0D1
Gene Alias
ATP6D, ATP6DV, P39, VATX, VMA6, VPATPD
Gene Description
ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d1
Omim ID
607028Gene Ontology
HyperlinkGene Summary
This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c'', and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This encoded protein is known as the D subunit and is found ubiquitously. [provided by RefSeq
Other Designations
ATPase, H+ transporting, lysosomal (vacuolar proton pump), member D|ATPase, H+ transporting, lysosomal 38kD, V0 subunit d|ATPase, H+ transporting, lysosomal, V0 subunit d1|H(+)-transporting two-sector ATPase, subunit D|V-ATPase 40 KDa accessory protein|V-
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Proteomic analysis of endosomes from genetically modified p14/MP1 mouse embryonic fibroblasts.
Stasyk T, Holzmann J, Stumberger S, Ebner HL, Hess MW, Bonn GK, Mechtler K, Huber LA.
Proteomics 2010 Nov; 10(22):4117.
Application:WB, Mouse, MEF cells.
-
Proteomic analysis of endosomes from genetically modified p14/MP1 mouse embryonic fibroblasts.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com