PIAS2 monoclonal antibody (M01), clone 1F7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PIAS2 is approximately 0.3ng/ml as a capture antibody.
RNAi Knockdown (Antibody validated)
Western blot analysis of PIAS2 over-expressed 293 cell line, cotransfected with PIAS2 Validated Chimera RNAi ( Cat # H00009063-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with PIAS2 monoclonal antibody (M01), clone 1F7 (Cat # H00009063-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between TP53 and PIAS2. HeLa cells were stained with anti-TP53 rabbit purified polyclonal 1:1200 and anti-PIAS2 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
Immunofluorescence
Immunofluorescence of monoclonal antibody to PIAS2 on HeLa cell . [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (35.53 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PIAS2.
Immunogen
PIAS2 (NP_004662, 385 a.a. ~ 473 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
CPVCDKKAAYESLILDGLFMEILNDCSDVDEIKFQEDGSWCPMRPKKEAMKVSSQPCTKIESSSVLSKPCSVTVASEASKKKVDVIDLT
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (98); Rat (97)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.53 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PIAS2 is approximately 0.3ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of PIAS2 over-expressed 293 cell line, cotransfected with PIAS2 Validated Chimera RNAi ( Cat # H00009063-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with PIAS2 monoclonal antibody (M01), clone 1F7 (Cat # H00009063-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between TP53 and PIAS2. HeLa cells were stained with anti-TP53 rabbit purified polyclonal 1:1200 and anti-PIAS2 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).Immunofluorescence
Immunofluorescence of monoclonal antibody to PIAS2 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — PIAS2
Entrez GeneID
9063GeneBank Accession#
NM_004671Protein Accession#
NP_004662Gene Name
PIAS2
Gene Alias
MGC102682, MIZ1, PIASX, PIASX-ALPHA, PIASX-BETA, SIZ2, ZMIZ4, miz
Gene Description
protein inhibitor of activated STAT, 2
Omim ID
603567Gene Ontology
HyperlinkGene Summary
This gene encodes a protein involved in the regulation of transcription factors involved in MAP kinase signaling. The symbol MIZ1 has also been associated with ZBTB17 which is a different gene located on chromosome 1. Two alternatively spliced transcripts encoding different isoforms have been described. [provided by RefSeq
Other Designations
Msx-interacting-zinc finger|protein inhibitor of activated STAT X|zinc finger, MIZ-type containing 4
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com