CLIC3 MaxPab rabbit polyclonal antibody (D01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human CLIC3 protein.
Immunogen
CLIC3 (NP_004660.2, 1 a.a. ~ 236 a.a) full-length human protein.
Sequence
MAETKLQLFVKASEDGESVGHCPSCQRLFMVLLLKGVPFTLTTVDTRRSPDVLKDFAPGSQLPILLYDSDAKTDTLQIEDFLEETLGPPDFPSLAPRYRESNTAGNDVFHKFSAFIKNPVPAQDEALYQQLLRALARLDSYLRAPLEHELAGEPQLRESRRRFLDGDRLTLADCSLLPKLHIVDTVCAHFRQAPIPAELRGVRRYLDSAMQEKEFKYTCPHSAEILAAYRPAVHPR
Host
Rabbit
Reactivity
Human, Mouse
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
CLIC3 MaxPab rabbit polyclonal antibody. Western Blot analysis of CLIC3 expression in mouse testis.Western Blot (Tissue lysate)
CLIC3 MaxPab rabbit polyclonal antibody. Western Blot analysis of CLIC3 expression in human placenta.Western Blot (Transfected lysate)
Western Blot analysis of CLIC3 expression in transfected 293T cell line (H00009022-T02) by CLIC3 MaxPab polyclonal antibody.
Lane 1: CLIC3 transfected lysate(26.60 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of CLIC3 transfected lysate using anti-CLIC3 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with CLIC3 purified MaxPab mouse polyclonal antibody (B01P) (H00009022-B01P). -
Gene Info — CLIC3
Entrez GeneID
9022GeneBank Accession#
NM_004669.2Protein Accession#
NP_004660.2Gene Name
CLIC3
Gene Alias
-
Gene Description
chloride intracellular channel 3
Omim ID
606533Gene Ontology
HyperlinkGene Summary
Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 3 is a member of the p64 family and is predominantly localized in the nucleus and stimulates chloride ion channel activity. In addition, this protein may participate in cellular growth control, based on its association with ERK7, a member of the MAP kinase family. [provided by RefSeq
Other Designations
OTTHUMP00000022630
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com