MTMR3 monoclonal antibody (M07), clone 1E11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant MTMR3.
Immunogen
MTMR3 (NP_066576.1, 579 a.a. ~ 674 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
CPSPTTPVDDSCAPYPAPGTSPDDPPLSRLPKTRSYDNLTTACDNTVPLASRRCSDPSLNEKWQEHRRSLELSSLAGPGEDPLSADSLGKPTRVPG
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (84); Rat (86)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.3 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of MTMR3 expression in transfected 293T cell line by MTMR3 monoclonal antibody (M07), clone 1E11.
Lane 1: MTMR3 transfected lysate(133.6 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MTMR3 is 0.1 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to MTMR3 on HeLa cell . [antibody concentration 15 ug/ml] -
Gene Info — MTMR3
Entrez GeneID
8897GeneBank Accession#
NM_021090Protein Accession#
NP_066576.1Gene Name
MTMR3
Gene Alias
FLJ32333, FYVE-DSP1, KIAA0371, ZFYVE10
Gene Description
myotubularin related protein 3
Omim ID
603558Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the myotubularin dual specificity protein phosphatase gene family. The encoded protein is structurally similar to myotubularin but in addition contains a FYVE domain and an N-terminal PH-GRAM domain. The protein can self-associate and also form heteromers with another myotubularin related protein. The protein binds to phosphoinositide lipids through the PH-GRAM domain, and can hydrolyze phosphatidylinositol(3)-phosphate and phosphatidylinositol(3,5)-biphosphate in vitro. The encoded protein has been observed to have a perinuclear, possibly membrane-bound, distribution in cells, but it has also been found free in the cytoplasm. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
FYVE (Fab1 YGLO23 Vsp27 EEA1 domain) dual-specificity protein phosphatase|myotubularin-related protein 3|zinc finger, FYVE domain containing 10
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com