ALKBH1 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of ALKBH1 expression in transfected 293T cell line (H00008846-T01) by ALKBH1 MaxPab polyclonal antibody.
Lane 1: ALKBH transfected lysate(42.79 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of purified MaxPab antibody to ALKBH1 on formalin-fixed paraffin-embedded human skeletal muscle. [antibody concentration 3 ug/ml]
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to ALKBH on HeLa cell. [antibody concentration 10 ug/ml]
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human ALKBH1 protein.
Immunogen
ALKBH1 (AAH25787.1, 1 a.a. ~ 389 a.a) full-length human protein.
Sequence
MGKMAAAVGSVATLATEPGEDAFRKLFRFYRQSRPGTADLEGVIDFSAAHAARGKGPGAQKVIKSQLNVSSVSEQNAYRAGLQPVSKWQAYGLKGYPGFIFIPNPFLPGYQWHWVKQCLKLYSQKPNVCNLDKHMSKEETQDLWEQSKEFLRYKEATKRRPRSLLEKLRWVTVGYHYNWDSKKYSADHYTPFPSDLGFLSEQVAAACGFEDFRAEAGILNYYRLDSTLGIHVDRSELDHSKPLLSFSFGQSAIFLLGGLQRDEAPTAMFMHSGDIMIMSGFSRLLNHAVPRVLPNPEGEGLPHCLEAPLPAVLPRDSMVEPCSMEDWQVCASYLKTARVNMTVRQVLATDQNFPLEPIEDEKRDISTEGFCHLDDQNSEVKRARINPHS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (82); Rat (75)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of ALKBH1 expression in transfected 293T cell line (H00008846-T01) by ALKBH1 MaxPab polyclonal antibody.
Lane 1: ALKBH transfected lysate(42.79 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of purified MaxPab antibody to ALKBH1 on formalin-fixed paraffin-embedded human skeletal muscle. [antibody concentration 3 ug/ml]Immunofluorescence
Immunofluorescence of purified MaxPab antibody to ALKBH on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — ALKBH1
Entrez GeneID
8846GeneBank Accession#
BC025787.1Protein Accession#
AAH25787.1Gene Name
ALKBH1
Gene Alias
ABH, ABH1, ALKBH, alkB, hABH
Gene Description
alkB, alkylation repair homolog 1 (E. coli)
Omim ID
605345Gene Ontology
HyperlinkGene Summary
This gene encodes a homolog to the E. coli alkB gene product. The E. coli alkB protein is part of the adaptive response mechanism of DNA alkylation damage repair. It is involved in damage reversal by oxidative demethylation of 1-methyladenine and 3-methylcytosine. [provided by RefSeq
Other Designations
alkylated DNA repair protein alkB homolog|alkylation repair, alkB homolog
-
Interactome
-
Publication Reference
-
RNA cytosine methyltransferase Nsun3 regulates embryonic stem cell differentiation by promoting mitochondrial activity.
Trixl L, Amort T, Wille A, Zinni M, Ebner S, Hechenberger C, Eichin F, Gabriel H, Schoberleitner I, Huang A, Piatti P, Nat R, Troppmair J, Lusser A.
Cellular and Molecular Life Sciences : CMLS 2017 Nov; [Epub].
Application：IF, Mouse, Mouse embryonic stem cells.
-
RNA cytosine methyltransferase Nsun3 regulates embryonic stem cell differentiation by promoting mitochondrial activity.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com