KLF11 monoclonal antibody (M03), clone 10D8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant KLF11.
Immunogen
KLF11 (NP_003588, 404 a.a. ~ 512 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
TYFKSSHLKAHLRTHTGEKPFNCSWDGCDKKFARSDELSRHRRTHTGEKKFVCPVCDRRFMRSDHLTKHARRHMTTKKIPGWQAEVGKLNRIASAESPGSPLVSMPASA
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (93)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.73 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
KLF11 monoclonal antibody (M03), clone 10D8. Western Blot analysis of KLF11 expression in PC-12.Western Blot (Cell lysate)
KLF11 monoclonal antibody (M03), clone 10D8. Western Blot analysis of KLF11 expression in Raw 264.7.Western Blot (Cell lysate)
KLF11 monoclonal antibody (M03), clone 10D8. Western Blot analysis of KLF11 expression in K-562.Western Blot (Transfected lysate)
Western Blot analysis of KLF11 expression in transfected 293T cell line by KLF11 monoclonal antibody (M03), clone 10D8.
Lane 1: KLF11 transfected lysate (Predicted MW: 55.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to KLF11 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to KLF11 on NIH/3T3 cell. [antibody concentration 10 ug/ml] -
Gene Info — KLF11
-
Interactome
-
Disease
-
Publication Reference
-
Molecular and Metabolic Analysis of Arsenic-Exposed Humanized AS3MT Mice.
Jenna Todero, Christelle Douillet, Alexandria J Shumway, Beverly H Koller, Matt Kanke, Daryl J Phuong, Miroslav Stýblo, Praveen Sethupathy.
Environmental Health Perspectives 2023 Dec; 131(12):127021.
Application:WB, Mice, Mice liver.
-
Survivin, sonic hedgehog, krüppel-like factors, and p53 pathway in serous ovarian cancer: an immunohistochemical study.
Ambrogio P Londero, Maria Orsaria, Luigi Viola, Stefania Marzinotto, Serena Bertozzi, Elena Galvano, Claudia Andreetta, Laura Mariuzzi.
Human Pathology 2022 Jun; 127:92.
Application:IHC-P, Human, Human ovarian cancer.
-
Molecular and Metabolic Analysis of Arsenic-Exposed Humanized AS3MT Mice.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com