KLF11 monoclonal antibody (M02), clone 10C5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
KLF11 monoclonal antibody (M02), clone 10C5. Western Blot analysis of KLF11 expression in NIH/3T3(Cat # L018V1 ).
Western Blot (Cell lysate)
KLF11 monoclonal antibody (M02), clone 10C5 Western Blot analysis of KLF11 expression in Hela S3 NE ( Cat # L013V3 ).
Western Blot detection against Immunogen (37.73 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant KLF11.
Immunogen
KLF11 (NP_003588, 404 a.a. ~ 512 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
TYFKSSHLKAHLRTHTGEKPFNCSWDGCDKKFARSDELSRHRRTHTGEKKFVCPVCDRRFMRSDHLTKHARRHMTTKKIPGWQAEVGKLNRIASAESPGSPLVSMPASA
Host
Mouse
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (93)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.73 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
KLF11 monoclonal antibody (M02), clone 10C5. Western Blot analysis of KLF11 expression in NIH/3T3(Cat # L018V1 ).Western Blot (Cell lysate)
KLF11 monoclonal antibody (M02), clone 10C5 Western Blot analysis of KLF11 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — KLF11
-
Interactome
-
Disease
-
Publication Reference
-
Prognostic Role of Krüppel-Like Factors 5, 9, and 11 in Endometrial Endometrioid Cancer.
Luigi Viola, Ambrogio P Londero, Serena Bertozzi, Maria Orsaria, Stefania Marzinotto, Fulvio Antoniazzi, Valentina Renda, Jacqueline Cinel, Arrigo Fruscalzo, Ralph J Lellé, Laura Mariuzzi.
Pathology Oncology Research 2020 Oct; 26(4):2265.
Application：IHC-P, Human, Endometrial endometrioid cancer.
-
Prognostic Role of Krüppel-Like Factors 5, 9, and 11 in Endometrial Endometrioid Cancer.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com