FZD5 monoclonal antibody (M01), clone 6A3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant FZD5.
Immunogen
FZD5 (ENSP00000354607, 72 a.a. ~ 161 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PLVEIQCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLMRQYGFAWPERMSCDRLPVLGRDAEVLCMDYNRSEATTAPPR
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.64 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of FZD5 expression in transfected 293T cell line by FZD5 monoclonal antibody (M01), clone 6A3.
Lane 1: FZD5 transfected lysate(64.5 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of FZD5 transfected lysate using anti-FZD5 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with FZD5 MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged FZD5 is approximately 0.3ng/ml as a capture antibody.ELISA
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between WNT5A and FZD5. HeLa cells were stained with anti-WNT5A rabbit purified polyclonal 1:1200 and anti-FZD5 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). -
Gene Info — FZD5
Entrez GeneID
7855GeneBank Accession#
NM_003468Protein Accession#
ENSP00000354607Gene Name
FZD5
Gene Alias
C2orf31, DKFZp434E2135, HFZ5, MGC129692
Gene Description
frizzled homolog 5 (Drosophila)
Omim ID
601723Gene Ontology
HyperlinkGene Summary
Members of the 'frizzled' gene family encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins. The FZD5 protein is believed to be the receptor for the Wnt5A ligand. [provided by RefSeq
Other Designations
Wnt receptor|frizzled 5|seven-transmembrane receptor frizzled-5
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Frizzled-5: a high affinity receptor for secreted frizzled-related protein-2 activation of nuclear factor of activated T-cells c3 signaling to promote angiogenesis.
Peterson YK, Nasarre P, Bonilla IV, Hilliard E, Samples J, Morinelli TA, Hill EG, Klauber-DeMore N.
Angiogenesis 2017 Aug; 20(4):615.
Application:IP-WB, Mouse, 2H11 cells.
-
Frizzled-5: a high affinity receptor for secreted frizzled-related protein-2 activation of nuclear factor of activated T-cells c3 signaling to promote angiogenesis.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com