UBE3A monoclonal antibody (M01), clone 2F6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
UBE3A monoclonal antibody (M01), clone 2F6. Western Blot analysis of UBE3A expression in PC-12.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to UBE3A on formalin-fixed paraffin-embedded human lung. [antibody concentration 3 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged UBE3A is approximately 0.03ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to UBE3A on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant UBE3A.
Immunogen
UBE3A (AAH09271, 51 a.a. ~ 150 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
ETFQQLITYKVISNEFNSRNLVNDDDAIVAASKCLKMVYYANVVGGEVDTNHNEEDDEEPIPESSELTLQELLGEERRNKKGPRVDPLETELGVKTLDCR
Host
Mouse
Reactivity
Human, Rat
Interspecies Antigen Sequence
Mouse (98); Rat (98)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
UBE3A monoclonal antibody (M01), clone 2F6. Western Blot analysis of UBE3A expression in PC-12.Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to UBE3A on formalin-fixed paraffin-embedded human lung. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged UBE3A is approximately 0.03ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to UBE3A on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — UBE3A
Entrez GeneID
7337GeneBank Accession#
BC009271Protein Accession#
AAH09271Gene Name
UBE3A
Gene Alias
ANCR, AS, E6-AP, EPVE6AP, FLJ26981, HPVE6A
Gene Description
ubiquitin protein ligase E3A
Gene Ontology
HyperlinkGene Summary
This gene encodes an E3 ubiquitin-protein ligase, part of the ubiquitin protein degradation system. This imprinted gene is maternally expressed in brain and biallelically expressed in other tissues. Maternally inherited deletion of this gene causes Angelman Syndrome, characterized by severe motor and intellectual retardation, ataxia, hypotonia, epilepsy, absence of speech, and characteristic facies. The protein also interacts with the E6 protein of human papillomavirus types 16 and 18, resulting in ubiquitination and proteolysis of tumor protein p53. Alternative splicing of this gene results in three transcript variants encoding three isoforms with different N-termini. Additional transcript variants have been described, but their full length nature has not been determined. [provided by RefSeq
Other Designations
CTCL tumor antigen se37-2|human papilloma virus E6-associated protein|oncogenic protein-associated protein E6-AP
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
The E6 proteins from multiple beta HPV types degrade Bak and protect keratinocytes from apoptosis after UVB irradiation.
Underbrink MP, Howie HL, Bedard KM, Koop JI, Galloway DA.
Journal of Virology 2008 Aug; 82(21):10408.
Application：WB, Human, Primary human foreskin keratinocytes (HFKs).
-
The E6 proteins from multiple beta HPV types degrade Bak and protect keratinocytes from apoptosis after UVB irradiation.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com