TMEM1 monoclonal antibody (M01), clone 5B4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant TMEM1.
Immunogen
TMEM1 (NP_003265, 1162 a.a. ~ 1257 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
VRLFKYLPHHSAHSSQLDADSWIENDSLSVDKHGDDQPDSSSLKSRGSVHSACSSEHKGLPMPRLQALPAGQVFNSSSGTQVLVIPSQDDHVLEVS
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.3 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
TMEM1 monoclonal antibody (M01), clone 5B4. Western Blot analysis of TRAPPC10 expression in Jurkat.Western Blot (Transfected lysate)
Western Blot analysis of TMEM1 expression in transfected 293T cell line by TMEM1 monoclonal antibody (M01), clone 5B4.
Lane 1: TMEM1 transfected lysate(142.2 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of TMEM1 over-expressed 293 cell line, cotransfected with TMEM1 Validated Chimera RNAi ( Cat # H00007109-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with TMEM1 monoclonal antibody (M01), clone 5B4 (Cat # H00007109-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — TRAPPC10
Entrez GeneID
7109GeneBank Accession#
NM_003274Protein Accession#
NP_003265Gene Name
TRAPPC10
Gene Alias
EHOC-1, EHOC1, FLJ54223, FLJ54817, FLJ55683, GT334, MGC126777, TMEM1, TRS130, TRS30
Gene Description
trafficking protein particle complex 10
Omim ID
602103Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a transmembrane protein found in the cis-Golgi complex. The encoded protein is part of the multisubunit transport protein particle (TRAPP) complex and may be involved in vesicular transport from the endoplasmic reticulum to the Golgi. Mutations in this gene could be responsible for the Unverricht-Lundborg type of progressive myoclonus epilepsy, or for autoimmune polyglandular disease type 1. [provided by RefSeq
Other Designations
TRAPP 130 kDa subunit|epilepsy holoprosencephaly candidate-1 protein|trafficking protein particle complex subunit 130|transmembrane protein 1|transport protein particle subunit TMEM1
-
Interactome
-
Disease
-
Publication Reference
-
TRAPPC9 Mediates the Interaction between p150 and COPII Vesicles at the Target Membrane.
Zong M, Satoh A, Yu MK, Siu KY, Ng WY, Chan HC, Tanner JA, Yu S.
PLoS One 2012 Jan; 7(1):e29995.
Application:WB-Tr, Human, COS, HEK293 cell.
-
TRAPPC9 Mediates the Interaction between p150 and COPII Vesicles at the Target Membrane.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com