TLN1 monoclonal antibody (M05), clone 5C1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant TLN1.
Immunogen
TLN1 (NP_006280, 1052 a.a. ~ 1149 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SALSVVQNLEKDLQEVKAAARDGKLKPLPGETMEKCTQDLGNSTKAVSSAIAQLLGEVAQGNENYAGIAARDVAGGLRSLAQAARGVAALTSDPAVQA
Host
Mouse
Reactivity
Human, Mouse, Rat
Isotype
IgG3 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.52 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
TLN1 monoclonal antibody (M05), clone 5C1. Western Blot analysis of TLN1 expression in Raw 264.7.Western Blot (Cell lysate)
TLN1 monoclonal antibody (M05), clone 5C1. Western Blot analysis of TLN1 expression in PC-12 ( Cat # L012V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to TLN1 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TLN1 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — TLN1
Entrez GeneID
7094GeneBank Accession#
NM_006289Protein Accession#
NP_006280Gene Name
TLN1
Gene Alias
ILWEQ, KIAA1027, TLN
Gene Description
talin 1
Omim ID
186745Gene Ontology
HyperlinkGene Summary
This gene encodes a cytoskeletal protein that is concentrated in areas of cell-substratum and cell-cell contacts. The encoded protein plays a significant role in the assembly of actin filaments and in spreading and migration of various cell types, including fibroblasts and osteoclasts. It codistributes with integrins in the cell surface membrane in order to assist in the attachment of adherent cells to extracellular matrices and of lymphocytes to other cells. The N-terminus of this protein contains elements for localization to cell-extracellular matrix junctions. The C-terminus contains binding sites for proteins such as beta-1-integrin, actin, and vinculin. [provided by RefSeq
Other Designations
-
-
Interactome
-
Pathway
-
Publication Reference
-
Improved detection of prostate cancer using a magneto-nanosensor assay for serum circulating autoantibodies.
Xu L, Lee JR, Hao S, Ling XB, Brooks JD, Wang SX, Gambhir SS.
PLoS One 2019 Aug; 14(8):e0221051.
Application:Func, Det Ab, Human, Human serum.
-
Improved detection of prostate cancer using a magneto-nanosensor assay for serum circulating autoantibodies.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com