T monoclonal antibody (M01), clone 5H8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant T.
Immunogen
T (NP_003172, 222 a.a. ~ 320 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
ERSDHKEMMEEPGDSQQPGYSQWGWLLPGTSTLCPPANPHPQFGGALSLPSTHSCDRYPTLRSHRSSPYPSPYAHRNNSPTYSDNSPACLSMLQSHDNW
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of T expression in transfected 293T cell line by T monoclonal antibody (M01), clone 5H8.
Lane 1: T transfected lysate(41.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged T is approximately 0.03ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of T over-expressed 293 cell line, cotransfected with T Validated Chimera RNAi ( Cat # H00006862-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with T monoclonal antibody (M01), clone 5H8 (Cat # H00006862-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — T
Entrez GeneID
6862GeneBank Accession#
NM_003181Protein Accession#
NP_003172Gene Name
T
Gene Alias
MGC104817, TFT
Gene Description
T, brachyury homolog (mouse)
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is an embryonic nuclear transcription factor that binds to a specific DNA element, the palindromic T-site. It binds through a region in its N-terminus, called the T-box, and effects transcription of genes required for mesoderm formation and differentiation. The protein is localized to notochord-derived cells. [provided by RefSeq
Other Designations
OTTHUMP00000017588|T brachyury homolog|T brachyury-like|transcription factor T
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com