STAT5A monoclonal antibody (M02), clone 1B12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
STAT5A monoclonal antibody (M02), clone 1B12 Western Blot analysis of STAT5A expression in k-562 ( Cat # L009V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of STAT5A expression in transfected 293T cell line by STAT5A monoclonal antibody (M02), clone 1B12.
Lane 1: STAT5A transfected lysate (Predicted MW: 90.6 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged STAT5A is approximately 0.1ng/ml as a capture antibody.
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between STAT1 and STAT5A. HeLa cells were stained with anti-STAT1 rabbit purified polyclonal 1:1200 and anti-STAT5A mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
Western Blot detection against Immunogen (37.07 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant STAT5A.
Immunogen
STAT5A (AAH27036, 1 a.a. ~ 104 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAGWIQAQQLQGDALRQMQVLYGQHFPIEVRHYLAQWIESQPWDAIDLDNPQDRAQATQLLEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQKTYDRCPLE
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.07 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
STAT5A monoclonal antibody (M02), clone 1B12 Western Blot analysis of STAT5A expression in k-562 ( Cat # L009V1 ).Western Blot (Transfected lysate)
Western Blot analysis of STAT5A expression in transfected 293T cell line by STAT5A monoclonal antibody (M02), clone 1B12.
Lane 1: STAT5A transfected lysate (Predicted MW: 90.6 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged STAT5A is approximately 0.1ng/ml as a capture antibody.ELISA
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between STAT1 and STAT5A. HeLa cells were stained with anti-STAT1 rabbit purified polyclonal 1:1200 and anti-STAT5A mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). -
Gene Info — STAT5A
Entrez GeneID
6776GeneBank Accession#
BC027036Protein Accession#
AAH27036Gene Name
STAT5A
Gene Alias
MGF, STAT5
Gene Description
signal transducer and activator of transcription 5A
Omim ID
601511Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the STAT family of transcription factors. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein is activated by, and mediates the responses of many cell ligands, such as IL2, IL3, IL7 GM-CSF, erythropoietin, thrombopoietin, and different growth hormones. Activation of this protein in myeloma and lymphoma associated with a TEL/JAK2 gene fusion is independent of cell stimulus and has been shown to be essential for the tumorigenesis. The mouse counterpart of this gene is found to induce the expression of BCL2L1/BCL-X(L), which suggests the antiapoptotic function of this gene in cells. [provided by RefSeq
Other Designations
-
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com