SNCG monoclonal antibody (M01), clone 2C3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SNCG.
Immunogen
SNCG (AAH14098, 21 a.a. ~ 127 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
KTKQGVTEAAEKTKEGVMYVGAKTKENVVQSVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIAVTSGVVRKEDLRPSAPQQEGEASKEKEEVAEEAQSGGD
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.4 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
SNCG monoclonal antibody (M01), clone 2C3. Western Blot analysis of SNCG expression in human spleen.Western Blot (Transfected lysate)
Western Blot analysis of SNCG expression in transfected 293T cell line by SNCG monoclonal antibody (M01), clone 2C3.
Lane 1: SNCG transfected lysate(13.3 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SNCG is 0.1 ng/ml as a capture antibody.ELISA
-
Gene Info — SNCG
Entrez GeneID
6623GeneBank Accession#
BC014098Protein Accession#
AAH14098Gene Name
SNCG
Gene Alias
BCSG1, SR
Gene Description
synuclein, gamma (breast cancer-specific protein 1)
Omim ID
602998Gene Ontology
HyperlinkGene Summary
Summary: This gene encodes a member of the synuclein family of proteins which are believed to be involved in the pathogenesis of neurodegenerative diseases. Mutations in this gene have also been associated with breast tumor development. [provided by RefSeq
Other Designations
OTTHUMP00000020013|breast cancer-specific protein 1|persyn|synoretin|synuclein, gamma (breast cancer-specific gene 1)
-
Interactome
-
Disease
-
Publication Reference
-
Pan-retinal ganglion cell markers in mice, rats, and rhesus macaques.
Francisco M Nadal-Nicolás, Caridad Galindo-Romero, Fernando Lucas-Ruiz, Nicholas Marsh-Amstrong, Wei Li, Manuel Vidal-Sanz, Marta Agudo-Barriuso.
Zoological Research 2023 Jan; 44(1):226.
Application:IF, Monkey, Mouse, Rat, Monkey retina, Mouse retina, Rat retina.
-
Multiomic Analysis of Neurons with Divergent Projection Patterns Identifies Novel Regulators of Axon Pathfinding.
Marta Fernández-Nogales, Maria Teresa López-Cascale, Verónica Murcia-Belmonte, Augusto Escalante, Jordi Fernández-Albert, Rafael Muñoz-Viana, Angel Barco, Eloísa Herrera.
Advanced Science (Weinheim, Baden-Württemberg, Germany) 2022 Aug; e2200615.
Application:IF, Mouse, Mouse coronal retinal.
-
Age Related Retinal Ganglion Cell Susceptibility in Context of Autophagy Deficiency.
Katharina Bell, Ines Rosignol, Elena Sierra-Filardi, Natalia Rodriguez-Muela, Carsten Schmelter, Francesco Cecconi, Franz Grus, Patricia Boya.
Cell Death Discovery 2020 Apr; 6:21.
Application:IF, IHC-Fr, Mouse, Mouse eyes.
-
Targeted disruption of dual leucine zipper kinase and leucine zipper kinase promotes neuronal survival in a model of diffuse traumatic brain injury.
Welsbie DS, Ziogas NK, Xu L, Kim BJ, Ge Y, Patel AK, Ryu J, Lehar M, Alexandris AS, Stewart N, Zack DJ, Koliatsos VE.
Molecular Neurodegeneration 2019 Nov; 14(1):44.
Application:IF, IHC-Fr, Mouse, Mouse eyes.
-
Adoptive transfer of immune cells from glaucomatous mice provokes retinal ganglion cell loss in recipients.
Gramlich OW, Ding QJ, Zhu W, Cook A, Anderson MG, Kuehn MH.
Acta Neuropathologica Communications 2015 Sep; 3:56.
Application:IF, Mouse, Retinae.
-
Pan-retinal ganglion cell markers in mice, rats, and rhesus macaques.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com