SMARCE1 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human SMARCE1 partial ORF ( NP_003070, 75 a.a. - 142 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
RYSRKVWDQVKASNPDLKLWEIGKIIGGMWRDLTDEEKQEYLNEYEAEKIEYNESMKAYHNSPAYLAY
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
33.22
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — SMARCE1
Entrez GeneID
6605GeneBank Accession#
NM_003079Protein Accession#
NP_003070Gene Name
SMARCE1
Gene Alias
BAF57
Gene Description
SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily e, member 1
Omim ID
603111Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is part of the large ATP-dependent chromatin remodeling complex SWI/SNF, which is required for transcriptional activation of genes normally repressed by chromatin. The encoded protein, either alone or when in the SWI/SNF complex, can bind to 4-way junction DNA, which is thought to mimic the topology of DNA as it enters or exits the nucleosome. The protein contains a DNA-binding HMG domain, but disruption of this domain does not abolish the DNA-binding or nucleosome-displacement activities of the SWI/SNF complex. Unlike most of the SWI/SNF complex proteins, this protein has no yeast counterpart. [provided by RefSeq
Other Designations
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin e1|mammalian chromatin remodeling complex BRG1-associated factor 57
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com