SMARCD3 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human SMARCD3 partial ORF ( NP_001003801, 385 a.a. - 483 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
ISALDSKIHETIESINQLKIQRDFMLSFSRDPKGYVQDLLRSQSRDLKVMTDVAGNPEEERRAEFYHQPWSQEAVSRYFYCKIQQRRQELEQSLVVRNT
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.63
Interspecies Antigen Sequence
Mouse (100); Rat (100)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — SMARCD3
Entrez GeneID
6604GeneBank Accession#
NM_001003801Protein Accession#
NP_001003801Gene Name
SMARCD3
Gene Alias
BAF60C, CRACD3, MGC111010, Rsc6p
Gene Description
SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 3
Omim ID
601737Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the SWI/SNF family of proteins, whose members display helicase and ATPase activities and which are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI and has sequence similarity to the yeast Swp73 protein. Multiple alternatively spliced transcript variants have been found for this gene, but the biological validity of some variants has not been determined. [provided by RefSeq
Other Designations
60kDa BRG-1/Brm associated factor subunit c|SWI/SNF complex 60 kDa subunit C|SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 3, isoform 1|Swp73-like protein|chromatin remodeling complex BAF60C subunit|mammal
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com