SGCA monoclonal antibody (M01), clone 3C4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of SGCA expression in transfected 293T cell line by SGCA monoclonal antibody (M01), clone 3C4.
Lane 1: SGCA transfected lysate(42.9 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SGCA is 1 ng/ml as a capture antibody.
Western Blot detection against Immunogen (37.62 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SGCA.
Immunogen
SGCA (NP_000014.1, 26 a.a. ~ 133 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
TTLHPLVGRVFVHTLDHETFLSLPEHVAVPPAVHITYHAHLQGHPDLPRWLRYTQRSPHHPGFLYGSATPEDRGLQVIEVTAYNRDSFDTTRQRLVLEIGDPEGPLLP
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (85); Rat (84)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.62 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of SGCA expression in transfected 293T cell line by SGCA monoclonal antibody (M01), clone 3C4.
Lane 1: SGCA transfected lysate(42.9 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SGCA is 1 ng/ml as a capture antibody.ELISA
-
Gene Info — SGCA
Entrez GeneID
6442GeneBank Accession#
NM_000023Protein Accession#
NP_000014.1Gene Name
SGCA
Gene Alias
50-DAG, A2, ADL, DAG2, DMDA2, LGMD2D, SCARMD1, adhalin
Gene Description
sarcoglycan, alpha (50kDa dystrophin-associated glycoprotein)
Gene Ontology
HyperlinkGene Summary
This gene encodes a component of the dystrophin-glycoprotein complex (DGC), which is critical to the stability of muscle fiber membranes and to the linking of the actin cytoskeleton to the extracellular matrix. Its expression is thought to be restricted to striated muscle. Mutations in this gene result in type 2D autosomal recessive limb-girdle muscular dystrophy. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
50kD DAG|sarcoglycan, alpha
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com