RPS6KB1 monoclonal antibody (M04), clone 4H4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant RPS6KB1.
Immunogen
RPS6KB1 (NP_003152, 416 a.a. ~ 525 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PSVLESVKEKFSFEPKIRSPRRFIGSPRTPVSPVKFSPGDFWGRGASASTANPQTPVEYPMETSGIEQMDVTMSGEASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL
Host
Mouse
Reactivity
Human, Mouse, Rat
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
RPS6KB1 monoclonal antibody (M04), clone 4H4. Western Blot analysis of RPS6KB1 expression in NIH/3T3(Cat # L018V1 ).Western Blot (Cell lysate)
RPS6KB1 monoclonal antibody (M04), clone 4H4. Western Blot analysis of RPS6KB1 expression in Raw 264.7(Cat # L024V1 ).Western Blot (Cell lysate)
RPS6KB1 monoclonal antibody (M04), clone 4H4. Western Blot analysis of RPS6KB1 expression in PC-12(Cat # L012V1 ).Western Blot (Cell lysate)
RPS6KB1 monoclonal antibody (M04), clone 4H4 Western Blot analysis of RPS6KB1 expression in HeLa ( Cat # L013V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RPS6KB1 is approximately 0.1ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to RPS6KB1 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — RPS6KB1
Entrez GeneID
6198GeneBank Accession#
NM_003161Protein Accession#
NP_003152Gene Name
RPS6KB1
Gene Alias
PS6K, S6K, S6K1, STK14A, p70(S6K)-alpha, p70-S6K, p70-alpha
Gene Description
ribosomal protein S6 kinase, 70kDa, polypeptide 1
Omim ID
608938Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains 2 non-identical kinase catalytic domains and phosphorylates several residues of the S6 ribosomal protein. The kinase activity of this protein leads to an increase in protein synthesis and cell proliferation. Amplification of the region of DNA encoding this gene and overexpression of this kinase are seen in some breast cancer cell lines. Alternate translational start sites have been described and alternate transcriptional splice variants have been observed but have not been thoroughly characterized. [provided by RefSeq
Other Designations
p70 S6 kinase, alpha 1|p70 S6 kinase, alpha 2|ribosomal protein S6 kinase, 70kD, polypeptide 1|serine/threonine kinase 14 alpha
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
O-cyclic phytosphingosine-1-phosphate stimulates HIF1α-dependent glycolytic reprogramming to enhance the therapeutic potential of mesenchymal stem cells.
Lee HJ, Jung YH, Choi GE, Kim JS, Chae CW, Lim JR, Kim SY, Lee JE, Park MC, Yoon JH, Choi MJ, Kim KS, Han HJ.
Cell Death & Disease 2019 Aug; 10(8):590.
Application:WB-Tr, Human, Human umbilical cord blood-derived mesenchymal stem cells.
-
O-cyclic phytosphingosine-1-phosphate stimulates HIF1α-dependent glycolytic reprogramming to enhance the therapeutic potential of mesenchymal stem cells.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com