RAD51L1 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of RAD51L1 expression in transfected 293T cell line (H00005890-T02) by RAD51L1 MaxPab polyclonal antibody.
Lane 1: RAD51L1 transfected lysate(42.20 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human RAD51L1 protein.
Immunogen
RAD51L1 (NP_598193.2, 1 a.a. ~ 384 a.a) full-length human protein.
Sequence
MGSKKLKRVGLSQELCDRLSRHQILTCQDFLCLSPLELMKVTGLSYRGVHELLCMVSRACAPKMQTAYGIKAQRSADFSPAFLSTTLSALDEALHGGVACGSLTEITGPPGCGKTQFCIMMSILATLPTNMGGLEGAVVYIDTESAFSAERLVEIAESRFPRYFNTEEKLLLTSSKVHLYRELTCDEVLQRIESLEEEIISKGIKLVILDSVASVVRKEFDAQLQGNLKERNKFLAREASSLKYLAEEFSIPVILTNQITTHLSGALASQADLVSPADDLSLSEGTSGSSCVIAALGNTWSHSVNTRLILQYLDSERRQILIAKSPLAPFTSFVYTIKEEGLVLQETTFCSVTQAELNWAPEILPPQPPEQLGLQMCHHTQLIF
Host
Rabbit
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of RAD51L1 expression in transfected 293T cell line (H00005890-T02) by RAD51L1 MaxPab polyclonal antibody.
Lane 1: RAD51L1 transfected lysate(42.20 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — RAD51L1
Entrez GeneID
5890GeneBank Accession#
NM_133509Protein Accession#
NP_598193.2Gene Name
RAD51L1
Gene Alias
MGC34245, R51H2, RAD51B, REC2, hREC2
Gene Description
RAD51-like 1 (S. cerevisiae)
Omim ID
602948Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the RAD51 protein family. RAD51 family members are evolutionarily conserved proteins essential for DNA repair by homologous recombination. This protein has been shown to form a stable heterodimer with the family member RAD51C, which further interacts with the other family members, such as RAD51, XRCC2, and XRCC3. Overexpression of this gene was found to cause cell cycle G1 delay and cell apoptosis, which suggested a role of this protein in sensing DNA damage. At least three alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq
Other Designations
DNA repair protein RAD51 homolog 2|RAD51 homolog B|RAD51-like 1|RecA-like protein|recombination repair protein
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com