MAPK6 monoclonal antibody (M02A), clone 4C11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant MAPK6.
Immunogen
MAPK6 (AAH35492, 612 a.a. ~ 721 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
EVRKDEQVEKENTYTSYLDKFFSRKEDTEMLETEPVEDGKLGERGHEEGFLNNSGEFLFNKQLESIGIPQFHSPVGSPLKSIQATLTPSAMKSSPQIPHQTYSSILKHLN
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (86); Rat (85)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In ascites fluid
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
MAPK6 monoclonal antibody (M02A), clone 4C11. Western Blot analysis of MAPK6 expression in Raw 264.7(Cat # L024V1 ).Western Blot (Cell lysate)
MAPK6 monoclonal antibody (M02A), clone 4C11. Western Blot analysis of MAPK6 expression in PC-12(Cat # L012V1 ).Western Blot (Cell lysate)
MAPK6 monoclonal antibody (M02A), clone 4C11 Western Blot analysis of MAPK6 expression in Jurkat ( Cat # L017V1 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — MAPK6
Entrez GeneID
5597GeneBank Accession#
BC035492Protein Accession#
AAH35492Gene Name
MAPK6
Gene Alias
DKFZp686F03189, ERK3, HsT17250, PRKM6, p97MAPK
Gene Description
mitogen-activated protein kinase 6
Omim ID
602904Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the Ser/Thr protein kinase family, and is most closely related to mitogen-activated protein kinases (MAP kinases). MAP kinases also known as extracellular signal-regulated kinases (ERKs), are activated through protein phosphorylation cascades and act as integration points for multiple biochemical signals. This kinase is localized in the nucleus, and has been reported to be activated in fibroblasts upon treatment with serum or phorbol esters. [provided by RefSeq
Other Designations
MAP kinase isoform p97|extracellular signal-regulated kinase 3|extracellular signal-regulated kinase, p97|protein kinase, mitogen-activated 5|protein kinase, mitogen-activated 6
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com