POLR2J monoclonal antibody (M02), clone 1A10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of POLR2J expression in transfected 293T cell line by POLR2J monoclonal antibody (M02), clone 1A10.
Lane 1: POLR2J transfected lysate(13.3 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged POLR2J is 0.3 ng/ml as a capture antibody.
Western Blot detection against Immunogen (38.61 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant POLR2J.
Immunogen
POLR2J (AAH24165, 1 a.a. ~ 117 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIKDKQEGIE
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (38.61 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of POLR2J expression in transfected 293T cell line by POLR2J monoclonal antibody (M02), clone 1A10.
Lane 1: POLR2J transfected lysate(13.3 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged POLR2J is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — POLR2J
Entrez GeneID
5439GeneBank Accession#
BC024165Protein Accession#
AAH24165Gene Name
POLR2J
Gene Alias
MGC71910, POLR2J1, RPB11, RPB11A, RPB11m, hRPB14
Gene Description
polymerase (RNA) II (DNA directed) polypeptide J, 13.3kDa
Omim ID
604150Gene Ontology
HyperlinkGene Summary
This gene encodes a subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. The product of this gene exists as a heterodimer with another polymerase subunit; together they form a core subassembly unit of the polymerase. Two similar genes are located nearby on chromosome 7q22.1 and a pseudogene is found on chromosome 7p13. [provided by RefSeq
Other Designations
DNA directed RNA polymerase II polypeptide J|polymerase (RNA) II (DNA directed) polypeptide J (13.3kD)
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com