PGAM1 monoclonal antibody (M01), clone 2G1-A6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant PGAM1.
Immunogen
PGAM1 (AAH11678.1, 1 a.a. ~ 254 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAAYKLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQKRAIRTLWTVLDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYDVPPPPMEPDHPFYSNISKDRRYADLTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKRVLIAAHGNSLRGIVKHLEGLSEEAIMELNLPTGIPIVYELDKNLKPIKPMQFLGDEETVRKAMEAVAAQGKAKK
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PGAM1 monoclonal antibody (M01), clone 2G1-A6 Western Blot analysis of PGAM1 expression in Jurkat ( Cat # L017V1 ).Western Blot (Transfected lysate)
Western Blot analysis of PGAM1 expression in transfected 293T cell line by PGAM1 monoclonal antibody (M01), clone 2G1-A6.
Lane 1: PGAM1 transfected lysate (Predicted MW: 28.8 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PGAM1 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — PGAM1
Entrez GeneID
5223GeneBank Accession#
BC011678Protein Accession#
AAH11678.1Gene Name
PGAM1
Gene Alias
PGAM-B, PGAMA
Gene Description
phosphoglycerate mutase 1 (brain)
Omim ID
172250Gene Ontology
HyperlinkGene Summary
nonmuscle form
Other Designations
OTTHUMP00000020190|OTTHUMP00000059414|phosphoglycerate mutase A, nonmuscle form
-
Interactome
-
Pathway
- Biosynthesis of alkaloids derived from histidine and purine
- Biosynthesis of alkaloids derived from ornithine
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of alkaloids derived from terpenoid and polyketide
- Biosynthesis of phenylpropanoids
- Biosynthesis of plant hormones
- Biosynthesis of terpenoids and steroids
- Glycolysis / Gluconeogenesis
- Metabolic pathways
-
Publication Reference
-
Comparative proteomic profiling of human bile reveals SSP411 as a novel biomarker of cholangiocarcinoma.
Shen J, Wang W, Wu J, Feng B, Chen W, Wang M, Tang J, Wang F, Cheng F, Pu L, Tang Q, Wang X, Li X.
PLoS One 2012 Oct; 7(10):e47476.
Application:IHC-P, WB, Human, Biles, Cholangiocarcinoma.
-
High prevalence of autoantibodies against phosphoglycerate mutase 1 in patients with autoimmune central nervous system diseases.
Kimura A, Sakurai T, Koumura A, Yamada M, Hayashi Y, Tanaka Y, Hozumi I, Tanaka R, Takemura M, Seishima M, Inuzuka T.
Journal of Neuroimmunology 2009 Dec; 219(1-2):105.
Application:WB, Human, Serum from patients with multiple sclerosis.
-
Comparative proteomic profiling of human bile reveals SSP411 as a novel biomarker of cholangiocarcinoma.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com