NCK1 monoclonal antibody (M01), clone 1A1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant NCK1.
Immunogen
NCK1 (AAH06403, 185 a.a. ~ 294 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
NLNTGQVLHVVQALYPFSSSNDEELNFEKGDVMDVIEKPENDPEWWKCRKINGMVGLVPKNYVTVMQNNPLTSGLEPSPPQCDYIRPSLTGKFAGNPWYYGKVTRHQAEM
Host
Mouse
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.73 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
NCK1 monoclonal antibody (M01), clone 1A1 Western Blot analysis of NCK1 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Transfected lysate)
Western Blot analysis of NCK1 expression in transfected 293T cell line by NCK1 monoclonal antibody (M01), clone 1A1.
Lane 1: NCK1 transfected lysate(42.9 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NCK1 is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — NCK1
Entrez GeneID
4690GeneBank Accession#
BC006403Protein Accession#
AAH06403Gene Name
NCK1
Gene Alias
MGC12668, NCK, NCKalpha
Gene Description
NCK adaptor protein 1
Omim ID
600508Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is one of the signaling and transforming proteins containing Src homology 2 and 3 (SH2 and SH3) domains. It is located in the cytoplasm and is an adaptor protein involved in transducing signals from receptor tyrosine kinases to downstream signal recipients such as RAS. [provided by RefSeq
Other Designations
NCK tyrosine kinase|SH2/SH3 adaptor protein NCK-alpha|melanoma NCK protein|non-catalytic region of tyrosine kinase
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com