NBL1 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human NBL1 protein.
Immunogen
NBL1 (NP_005371.1, 1 a.a. ~ 180 a.a) full-length human protein.
Sequence
MLRVLVGAVLPAMLLAAPPPINKLALFPDKSAWCEAKNITQIVGHSGCEAKSIQNRACLGQCFSYSVPNTFPQSTESLVHCDSCMPAQSMWEIVTLECPGHEEVPRVDKLVEKILHCSCQACGKEPSHEGLSVYVQGEDGPGSQPGTHPHPHPHPHPGGQTPEPEDPPGAPHTEEEGAED
Host
Rabbit
Reactivity
Human, Mouse
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
NBL1 MaxPab rabbit polyclonal antibody. Western Blot analysis of NBL1 expression in human colon.Western Blot (Tissue lysate)
NBL1 MaxPab rabbit polyclonal antibody. Western Blot analysis of NBL1 expression in mouse lung.Western Blot (Transfected lysate)
Western Blot analysis of NBL1 expression in transfected 293T cell line (H00004681-T01) by NBL1 MaxPab polyclonal antibody.
Lane 1: NBL1 transfected lysate(19.30 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — NBL1
Entrez GeneID
4681GeneBank Accession#
NM_005380Protein Accession#
NP_005371.1Gene Name
NBL1
Gene Alias
D1S1733E, DAN, DAND1, MGC8972, NB, NO3
Gene Description
neuroblastoma, suppression of tumorigenicity 1
Omim ID
600613Gene Ontology
HyperlinkGene Summary
This gene product is the founding member of the evolutionarily conserved CAN (Cerberus and DAN) family of proteins, which contain a domain resembling the CTCK (C-terminal cystine knot-like) motif found in a number of signaling molecules. These proteins are secreted, and act as BMP (bone morphogenetic protein) antagonists by binding to BMPs and preventing them from interacting with their receptors. They may thus play an important role during growth and development. Alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq
Other Designations
differential screening-selected gene aberrant in neuroblastoma|neuroblastoma candidate region, suppression of tumorigenicity 1|neuroblastoma suppressor of tumorigenicity 1
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com