MTAP monoclonal antibody (M01J), clone 2G4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant MTAP.
This product is belong to Cell Culture Grade Antibody (CX Grade).Immunogen
MTAP (AAH18625, 1 a.a. ~ 154 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MASGTTTTAVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDCILLARHGRQHTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDIVIIDQFIDSHVRRACFPFTFHHDCFQRPPQKPSRSHCVSCATCRTMS
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (89)
Preparation Method
Cell Culture Production
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (42.68 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
MTAP monoclonal antibody (M01J), clone 2G4. Western Blot analysis of MTAP expression in HeLa.Western Blot (Cell lysate)
MTAP monoclonal antibody (M01J), clone 2G4. Western Blot analysis of MTAP expression in Raw 264.7.Western Blot (Cell lysate)
MTAP monoclonal antibody (M01J), clone 2G4. Western Blot analysis of MTAP expression in NIH/3T3.Western Blot (Cell lysate)
MTAP monoclonal antibody (M01J), clone 2G4. Western Blot analysis of MTAP expression in PC-12.Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MTAP is 0.3 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to MTAP on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — MTAP
Entrez GeneID
4507GeneBank Accession#
BC018625Protein Accession#
AAH18625Gene Name
MTAP
Gene Alias
MSAP, c86fus
Gene Description
methylthioadenosine phosphorylase
Omim ID
156540Gene Ontology
HyperlinkGene Summary
This gene encodes an enzyme that plays a major role in polyamine metabolism and is important for the salvage of both adenine and methionine. The encoded enzyme is deficient in many cancers because this gene and the tumor suppressor p16 gene are co-deleted. Multiple alternatively spliced transcript variants have been described for this gene, but their full-length natures remain unknown. [provided by RefSeq
Other Designations
5'-methylthioadenosine phosphorylase|MeSAdo phosphorylase|OTTHUMP00000021152
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Short 57 kb CDKN2A FISH probe effectively detects short homozygous deletion of the 9p21 locus in malignant pleural mesothelioma.
Yuzo Oyama, Makoto Hamasaki, Shinji Matsumoto, Ayuko Sato, Tohru Tsujimura, Kazuki Nabeshima.
Oncology Letters 2021 Dec; 22(6):813.
Application:IHC-P, Human, Human malignant pleural mesothelioma.
-
Short 57 kb CDKN2A FISH probe effectively detects short homozygous deletion of the 9p21 locus in malignant pleural mesothelioma.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com