MCM2 monoclonal antibody (M01), clone 6A8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant MCM2.
Immunogen
MCM2 (AAH07670, 805 a.a. ~ 904 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
TQKFSVMRSMRKTFARYLSFRRDNNELLLFILKQLVAEQVTYQRNRFGAQQDTIEVPEKDLVDKARQINIHNLSAFYDSELFRMNKFSHDLKRKMILQQF
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (92); Rat (92)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
MCM2 monoclonal antibody (M01), clone 6A8 Western Blot analysis of MCM2 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Transfected lysate)
Western Blot analysis of MCM2 expression in transfected 293T cell line by MCM2 monoclonal antibody (M01), clone 6A8.
Lane 1: MCM2 transfected lysate(101.9 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of MCM2 transfected lysate using anti-MCM2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with MCM2 MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MCM2 is approximately 0.1ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to MCM2 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — MCM2
Entrez GeneID
4171GeneBank Accession#
BC007670Protein Accession#
AAH07670Gene Name
MCM2
Gene Alias
BM28, CCNL1, CDCL1, D3S3194, KIAA0030, MGC10606, MITOTIN, cdc19
Gene Description
minichromosome maintenance complex component 2
Omim ID
116945Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are involved in the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein forms a complex with MCM4, 6, and 7, and has been shown to regulate the helicase activity of the complex. This protein is phosphorylated, and thus regulated by, protein kinases CDC2 and CDC7. [provided by RefSeq
Other Designations
DNA replication licensing factor MCM2|MCM2 minichromosome maintenance deficient 2, mitotin|cell devision cycle-like 1|cyclin-like 1|minichromosome maintenance deficient 2 (mitotin)|nuclear protein BM28
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
C16orf72/HAPSTR1/TAPR1 functions with BRCA1/Senataxin to modulate replication-associated R-loops and confer resistance to PARP disruption.
Abhishek Bharadwaj Sharma, Muhammad Khairul Ramlee, Joel Kosmin, Martin R Higgs, Amy Wolstenholme, George E Ronson, Dylan Jones, Daniel Ebner, Noor Shamkhi, David Sims, Paul W G Wijnhoven, Josep V Forment, Ian Gibbs-Seymour, Nicholas D Lakin.
Nature Communications 2023 Aug; 14(1):5003.
Application:N/A, N/A, N/A.
-
C16orf72/HAPSTR1/TAPR1 functions with BRCA1/Senataxin to modulate replication-associated R-loops and confer resistance to PARP disruption.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com