NBR1 monoclonal antibody (M05), clone 5C3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant NBR1.
Immunogen
NBR1 (NP_005890, 2 a.a. ~ 96 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
EPQVTLNVTFKNEIQSFLVSDPENTTWADIEAMVKVSFDLNTIQIKYLDEENEEVSINSQGEYEEALKMAVKQGNQLQMQVHEGHHVVDEAPPPV
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.19 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of NBR1 expression in transfected 293T cell line by NBR1 monoclonal antibody (M05), clone 5C3.
Lane 1: NBR1 transfected lysate(107.4 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NBR1 is approximately 0.03ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of NBR1 over-expressed 293 cell line, cotransfected with NBR1 Validated Chimera RNAi ( Cat # H00004077-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with NBR1 monoclonal antibody (M05), clone 5C3 (Cat # H00004077-M05 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — NBR1
Entrez GeneID
4077GeneBank Accession#
NM_005899Protein Accession#
NP_005890Gene Name
NBR1
Gene Alias
1A1-3B, KIAA0049, M17S2, MIG19
Gene Description
neighbor of BRCA1 gene 1
Omim ID
166945Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene was originally identified as an ovarian tumor antigen monitored in ovarian cancer. The encoded protein contains a B-box/coiled coil motif, which is present in many genes with transformation potential, but the function of this protein is unknown. This gene is located on a region of chromosome 17q21.1 that is in close proximity to tumor suppressor gene BRCA1. Three alternatively spliced variants encoding the same protein have been identified for this gene. [provided by RefSeq
Other Designations
membrane component, chromosome 17, surface marker 2 (ovarian carcinoma antigen CA125)|migration-inducing protein 19
-
Interactome
-
Disease
-
Publication Reference
-
The p38-activated ER stress-ATF6α axis mediates cellular senescence.
Kim HS, Kim Y, Lim MJ, Park YG, Park SI, Sohn J.
FASEB Journal 2018 Sep; fj201800836R.
Application:WB-Tr, Human, MCF-7 cells.
-
The p38-activated ER stress-ATF6α axis mediates cellular senescence.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com