LAIR1 monoclonal antibody (M01), clone 2G4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of LAIR1 expression in transfected 293T cell line by LAIR1 monoclonal antibody (M01), clone 2G4.
Lane 1: LAIR1 transfected lysate(31.4 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged LAIR1 is approximately 1ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant LAIR1.
Immunogen
LAIR1 (NP_002278.1, 188 a.a. ~ 287 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
RQNQIKQGPPRSKDEEQKPQQRPDLAVDVLERTADKATVNGLPEKDRETDTSALAAGSSQEVTYAQLDHWALTQRTARAVSPQSTKPMAESITYAAVARH
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of LAIR1 expression in transfected 293T cell line by LAIR1 monoclonal antibody (M01), clone 2G4.
Lane 1: LAIR1 transfected lysate(31.4 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged LAIR1 is approximately 1ng/ml as a capture antibody.ELISA
-
Gene Info — LAIR1
Entrez GeneID
3903GeneBank Accession#
NM_002287Protein Accession#
NP_002278.1Gene Name
LAIR1
Gene Alias
CD305, LAIR-1
Gene Description
leukocyte-associated immunoglobulin-like receptor 1
Omim ID
602992Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is an inhibitory receptor found on peripheral mononuclear cells, including NK cells, T cells, and B cells. Inhibitory receptors regulate the immune response to prevent lysis of cells recognized as self. The gene is a member of both the immunoglobulin superfamily and the leukocyte-associated inhibitory receptor family. The gene maps to a region of 19q13.4 called the leukocyte receptor cluster, which contains at least 29 genes encoding leukocyte-expressed receptors of the immunoglobulin superfamily. [provided by RefSeq
Other Designations
leukocyte-associated Ig-like receptor 1
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com