RANBP5 monoclonal antibody (M01), clone 1C4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant RANBP5.
Immunogen
RANBP5 (AAH01497, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAAAAAEQQQFYLLLGNLLSPDNVVRKQAEETYENIPGQSKITFLLQAIRNTTAAEEARQMAAVLLRRLLSSAFDEVYPALPSDVQTAIKSELLMIIQME
Host
Mouse
Reactivity
Human, Mouse, Rat
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
RANBP5 monoclonal antibody (M01), clone 1C4. Western Blot analysis of IPO5 expression in Raw 264.7.Western Blot (Cell lysate)
RANBP5 monoclonal antibody (M01), clone 1C4 Western Blot analysis of RANBP5 expression in HeLa ( Cat # L013V1 ).Western Blot (Cell lysate)
RANBP5 monoclonal antibody (M01), clone 1C4. Western Blot analysis of IPO5 expression in PC-12.Western Blot (Transfected lysate)
Western Blot analysis of IPO5 expression in transfected 293T cell line by RANBP5 monoclonal antibody (M01), clone 1C4.
Lane 1: IPO5 transfected lysate (Predicted MW: 125.6 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to RANBP5 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RANBP5 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — IPO5
Entrez GeneID
3843GeneBank Accession#
BC001497Protein Accession#
AAH01497Gene Name
IPO5
Gene Alias
DKFZp686O1576, FLJ43041, IMB3, KPNB3, MGC2068, RANBP5
Gene Description
importin 5
Omim ID
602008Gene Ontology
HyperlinkGene Summary
Nucleocytoplasmic transport, a signal- and energy-dependent process, takes place through nuclear pore complexes embedded in the nuclear envelope. The import of proteins containing a nuclear localization signal (NLS) requires the NLS import receptor, a heterodimer of importin alpha and beta subunits also known as karyopherins. Importin alpha binds the NLS-containing cargo in the cytoplasm and importin beta docks the complex at the cytoplasmic side of the nuclear pore complex. In the presence of nucleoside triphosphates and the small GTP binding protein Ran, the complex moves into the nuclear pore complex and the importin subunits dissociate. Importin alpha enters the nucleoplasm with its passenger protein and importin beta remains at the pore. Interactions between importin beta and the FG repeats of nucleoporins are essential in translocation through the pore complex. The protein encoded by this gene is a member of the importin beta family. [provided by RefSeq
Other Designations
OTTHUMP00000040733|RAN binding protein 5|Ran_GTP binding protein 5|importin beta-3 subunit|karyopherin (importin) beta 3
-
Interactome
-
Disease
-
Publication Reference
-
Fas-Associated Factor 1 Negatively Regulates Antiviral Immune Response by Inhibiting Translocation of IRF3 to the Nucleus.
Song S, Lee JJ, Kim HJ, Lee JY, Chang J, Lee KJ.
Molecular and Cellular Biology 2016 Jan; 36(7):1136.
Application:WB-Ce, Human, HeLa, HEK293T cells.
-
Localization of retinitis pigmentosa 2 to cilia is regulated by Importin {beta}2.
Hurd TW, Fan S, Margolis BL.
Journal of Cell Science 2011 Mar; 124(Pt 5):718.
Application:WB, Dog, MDCK cells.
-
Fas-Associated Factor 1 Negatively Regulates Antiviral Immune Response by Inhibiting Translocation of IRF3 to the Nucleus.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com