RANBP5 monoclonal antibody (M01), clone 1C4

Catalog # H00003843-M01

Size

Price

Stock

Quantity

Size:100 ug
Price: USD $ 335.00
Stock:
order now, ship next day
abnova-minus
abnova-plus

* The price is valid only in USA. Please select country.

Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
Images
Western Blot (Cell lysate)
Application

Western Blot (Cell lysate)

RANBP5 monoclonal antibody (M01), clone 1C4. Western Blot analysis of IPO5 expression in Raw 264.7.

Western Blot (Cell lysate)
Application

Western Blot (Cell lysate)

RANBP5 monoclonal antibody (M01), clone 1C4 Western Blot analysis of RANBP5 expression in HeLa ( Cat # L013V1 ).

Western Blot (Cell lysate)
Application

Western Blot (Cell lysate)

RANBP5 monoclonal antibody (M01), clone 1C4. Western Blot analysis of IPO5 expression in PC-12.

Western Blot (Transfected lysate)
Application

Western Blot (Transfected lysate)

Western Blot analysis of IPO5 expression in transfected 293T cell line by RANBP5 monoclonal antibody (M01), clone 1C4.

Lane 1: IPO5 transfected lysate (Predicted MW: 125.6 KDa).
Lane 2: Non-transfected lysate.

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Application

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)

Immunoperoxidase of monoclonal antibody to RANBP5 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 3 ug/ml]

Sandwich ELISA (Recombinant protein)
Application

Sandwich ELISA (Recombinant protein)

Detection limit for recombinant GST tagged RANBP5 is approximately 0.03ng/ml as a capture antibody.

QC Test

Western Blot detection against Immunogen (36.74 KDa) .

  • Specification

    Product Description

    Mouse monoclonal antibody raised against a partial recombinant RANBP5.

    Immunogen

    RANBP5 (AAH01497, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

    Sequence

    MAAAAAEQQQFYLLLGNLLSPDNVVRKQAEETYENIPGQSKITFLLQAIRNTTAAEEARQMAAVLLRRLLSSAFDEVYPALPSDVQTAIKSELLMIIQME

    Host

    Mouse

    Reactivity

    Human, Mouse, Rat

    Isotype

    IgG1 Kappa

    Quality Control Testing

    Antibody Reactive Against Recombinant Protein.

    Western Blot detection against Immunogen (36.74 KDa) .

    Storage Buffer

    In 1x PBS, pH 7.4

    Storage Instruction

    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

  • Applications

    Western Blot (Cell lysate)

    RANBP5 monoclonal antibody (M01), clone 1C4. Western Blot analysis of IPO5 expression in Raw 264.7.

    Western Blot (Cell lysate)

    RANBP5 monoclonal antibody (M01), clone 1C4 Western Blot analysis of RANBP5 expression in HeLa ( Cat # L013V1 ).

    Western Blot (Cell lysate)

    RANBP5 monoclonal antibody (M01), clone 1C4. Western Blot analysis of IPO5 expression in PC-12.

    Western Blot (Transfected lysate)

    Western Blot analysis of IPO5 expression in transfected 293T cell line by RANBP5 monoclonal antibody (M01), clone 1C4.

    Lane 1: IPO5 transfected lysate (Predicted MW: 125.6 KDa).
    Lane 2: Non-transfected lysate.

    Western Blot (Recombinant protein)

    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)

    Immunoperoxidase of monoclonal antibody to RANBP5 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 3 ug/ml]

    Sandwich ELISA (Recombinant protein)

    Detection limit for recombinant GST tagged RANBP5 is approximately 0.03ng/ml as a capture antibody.

    ELISA

  • Gene Info — IPO5

    Entrez GeneID

    3843

    GeneBank Accession#

    BC001497

    Protein Accession#

    AAH01497

    Gene Name

    IPO5

    Gene Alias

    DKFZp686O1576, FLJ43041, IMB3, KPNB3, MGC2068, RANBP5

    Gene Description

    importin 5

    Omim ID

    602008

    Gene Ontology

    Hyperlink

    Gene Summary

    Nucleocytoplasmic transport, a signal- and energy-dependent process, takes place through nuclear pore complexes embedded in the nuclear envelope. The import of proteins containing a nuclear localization signal (NLS) requires the NLS import receptor, a heterodimer of importin alpha and beta subunits also known as karyopherins. Importin alpha binds the NLS-containing cargo in the cytoplasm and importin beta docks the complex at the cytoplasmic side of the nuclear pore complex. In the presence of nucleoside triphosphates and the small GTP binding protein Ran, the complex moves into the nuclear pore complex and the importin subunits dissociate. Importin alpha enters the nucleoplasm with its passenger protein and importin beta remains at the pore. Interactions between importin beta and the FG repeats of nucleoporins are essential in translocation through the pore complex. The protein encoded by this gene is a member of the importin beta family. [provided by RefSeq

    Other Designations

    OTTHUMP00000040733|RAN binding protein 5|Ran_GTP binding protein 5|importin beta-3 subunit|karyopherin (importin) beta 3

  • Interactome
  • Disease
  • Publication Reference
Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
4 Products to Compare
Remove All