ID1 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of ID1 expression in transfected 293T cell line (H00003397-T01) by ID1 MaxPab polyclonal antibody.
Lane 1: ID1 transfected lysate(17.05 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to ID1 on HeLa cell. [antibody concentration 10 ug/ml]
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human ID1 protein.
Immunogen
ID1 (NP_002156.2, 1 a.a. ~ 155 a.a) full-length human protein.
Sequence
MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQQVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGGRGLPVRAPLSTLNGEISALTAEAACVPADDRILCR
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of ID1 expression in transfected 293T cell line (H00003397-T01) by ID1 MaxPab polyclonal antibody.
Lane 1: ID1 transfected lysate(17.05 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to ID1 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — ID1
Entrez GeneID
3397GeneBank Accession#
NM_002165Protein Accession#
NP_002156.2Gene Name
ID1
Gene Alias
ID, bHLHb24
Gene Description
inhibitor of DNA binding 1, dominant negative helix-loop-helix protein
Omim ID
600349Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a helix-loop-helix (HLH) protein that can form heterodimers with members of the basic HLH family of transcription factors. The encoded protein has no DNA binding activity and therefore can inhibit the DNA binding and transcriptional activation ability of basic HLH proteins with which it interacts. This protein may play a role in cell growth, senescence, and differentiation. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
DNA-binding protein inhibitor ID-1|OTTHUMP00000030534|OTTHUMP00000030535|dJ857M17.1.2 (inhibitor of DNA binding 1, dominant negative helix-loop-helix protein)|inhibitor of DNA binding 1|inhibitor of differentiation 1
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com