ICA1 monoclonal antibody (M01), clone 6G11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of ICA1 expression in transfected 293T cell line by ICA1 monoclonal antibody (M01), clone 6G11.
Lane 1: ICA1 transfected lysate (Predicted MW: 54.6 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ICA1 is approximately 0.3ng/ml as a capture antibody.
Western Blot detection against Immunogen (37.84 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ICA1.
Immunogen
ICA1 (NP_071682, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MSGHKCSYPWDLQDRYAQDKSVVNKMQQKYWETKQAFIKATGKKEDEHVVASDADLDAKLELFHSIQRTCLDLSKAIVLYQKRICFLSQEENELGKFLRSQGFQDKTRAG
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (96); Rat (96)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of ICA1 expression in transfected 293T cell line by ICA1 monoclonal antibody (M01), clone 6G11.
Lane 1: ICA1 transfected lysate (Predicted MW: 54.6 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ICA1 is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — ICA1
Entrez GeneID
3382GeneBank Accession#
NM_022307Protein Accession#
NP_071682Gene Name
ICA1
Gene Alias
ICA69, ICAp69
Gene Description
islet cell autoantigen 1, 69kDa
Omim ID
147625Gene Ontology
HyperlinkGene Summary
This gene encodes a protein with an arfaptin homology domain that is found both in the cytosol and as membrane-bound form on the Golgi complex and immature secretory granules. This protein is believed to be an autoantigen in insulin-dependent diabetes mellitus and primary Sjogren's syndrome. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized. [provided by RefSeq
Other Designations
diabetes mellitus type I autoantigen|islet cell autoantigen 1|islet cell autoantigen 1 (69kD)|islet cell autoantigen 1 isoform|islet cell autoantigen p69
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com