MSH6 monoclonal antibody (M01), clone 1F2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
MSH6 monoclonal antibody (M01), clone 1F2. Western Blot analysis of MSH6 expression in human kidney.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MSH6 is approximately 1ng/ml as a capture antibody.
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between MSH2 and MSH6. HeLa cells were stained with anti-MSH2 rabbit purified polyclonal 1:1200 and anti-MSH6 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
Immunofluorescence
Immunofluorescence of monoclonal antibody to MSH6 on HeLa cell . [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant MSH6.
Immunogen
MSH6 (NP_000170, 931 a.a. ~ 1030 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
AGFDSDYDQALADIRENEQSLLEYLEKQRNRIGCRTIVYWGIGRNRYQLEIPENFTTRNLPEEYELKSTKKGCKRYWTKTIEKKLANLINAEERRDVSLK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (93)
Isotype
IgG1 kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
MSH6 monoclonal antibody (M01), clone 1F2. Western Blot analysis of MSH6 expression in human kidney.Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MSH6 is approximately 1ng/ml as a capture antibody.ELISA
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between MSH2 and MSH6. HeLa cells were stained with anti-MSH2 rabbit purified polyclonal 1:1200 and anti-MSH6 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).Immunofluorescence
Immunofluorescence of monoclonal antibody to MSH6 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — MSH6
Entrez GeneID
2956GeneBank Accession#
NM_000179Protein Accession#
NP_000170Gene Name
MSH6
Gene Alias
GTBP, HNPCC5, HSAP
Gene Description
mutS homolog 6 (E. coli)
Omim ID
600678Gene Ontology
HyperlinkGene Summary
This gene encodes a protein similar to the MutS protein. In E. coli, the MutS protein helps in the recognition of mismatched nucleotides, prior to their repair. A highly conserved region of approximately 150 aa, called the Walker-A adenine nucleotide binding motif, exists in MutS homologs. The encoded protein of this gene combines with MSH2 to form a mismatch recognition complex that functions as a bidirectional molecular switch that exchanges ADP and ATP as DNA mismatches are bound and dissociated. Mutations in this gene have been identified in individuals with hereditary nonpolyposis colon cancer (HNPCC) and endometrial cancer. [provided by RefSeq
Other Designations
G/T mismatch-binding protein|mutS homolog 6|sperm-associated protein
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com