GCN5L2 monoclonal antibody (M06), clone 3F8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
GCN5L2 monoclonal antibody (M06), clone 3F8. Western Blot analysis of GCN5L2 expression in human lung cancer.
Western Blot (Cell lysate)
GCN5L2 monoclonal antibody (M06), clone 3F8. Western Blot analysis of GCN5L2 expression in RIN-m5F.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to GCN5L2 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant GCN5L2.
Immunogen
GCN5L2 (AAH32743, 738 a.a. ~ 837 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
KNLLAQIKSHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTERLRSRYYVTRKLFVADLQRVIANCREYNPPDSEYCRCASALEKFFYFKLKEGGLIDK
Host
Mouse
Reactivity
Human, Rat
Interspecies Antigen Sequence
Mouse (100); Rat (100)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
GCN5L2 monoclonal antibody (M06), clone 3F8. Western Blot analysis of GCN5L2 expression in human lung cancer.Western Blot (Cell lysate)
GCN5L2 monoclonal antibody (M06), clone 3F8. Western Blot analysis of GCN5L2 expression in RIN-m5F.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to GCN5L2 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]ELISA
-
Gene Info — KAT2A
Entrez GeneID
2648GeneBank Accession#
BC032743Protein Accession#
AAH32743Gene Name
KAT2A
Gene Alias
GCN5, GCN5L2, MGC102791, PCAF-b, hGCN5
Gene Description
K(lysine) acetyltransferase 2A
Omim ID
602301Gene Ontology
HyperlinkGene Summary
KAT2A, or GCN5, is a histone acetyltransferase (HAT) that functions primarily as a transcriptional activator. It also functions as a repressor of NF-kappa-B (see MIM 164011) by promoting ubiquitination of the NF-kappa-B subunit RELA (MIM 164014) in a HAT-independent manner (Mao et al., 2009 [PubMed 19339690]).[supplied by OMIM
Other Designations
GCN5 (general control of amino-acid synthesis, yeast, homolog)-like 2|GCN5 general control of amino-acid synthesis 5-like 2|General control of amino acid synthesis, yeast, homolog-like 2
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com