FCGRT (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Human FCGRT partial ORF ( AAH08734, 51 a.a. - 160 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
GWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAI
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
37.84
Interspecies Antigen Sequence
Mouse (72); Rat (71)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — FCGRT
Entrez GeneID
2217GeneBank Accession#
BC008734Protein Accession#
AAH08734Gene Name
FCGRT
Gene Alias
FCRN, alpha-chain
Gene Description
Fc fragment of IgG, receptor, transporter, alpha
Omim ID
601437Gene Ontology
HyperlinkGene Summary
This gene encodes a receptor that binds the Fc region of monomeric immunoglobulin G. The encoded protein transfers immunoglobulin G antibodies from mother to fetus across the placenta. This protein also binds immunoglobulin G to protect the antibody from degradation. Alternative splicing results in multiple transcript variants. [provided by RefSeq
Other Designations
FcRn alpha chain|IgG Gc receptor|neonatal Fc-receptor
-
Interactomes
-
Diseases
-
Publication Reference
-
Internalization of bevacizumab by retinal endothelial cells and its intracellular fate: evidence for an involvement of the neonatal Fc receptor.
Deissler HL, Lang GK, Lang GE.
Experimental Eye Research 2016 Feb; 143:49.
Application:WB, Bovine, Endothelial cells.
-
Internalization of bevacizumab by retinal endothelial cells and its intracellular fate: evidence for an involvement of the neonatal Fc receptor.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com