EDG1 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
EDG1 MaxPab rabbit polyclonal antibody. Western Blot analysis of EDG1 expression in mouse lung.
Western Blot (Transfected lysate)
Western Blot analysis of S1PR1 expression in transfected 293T cell line (H00001901-T01) by S1PR1 MaxPab polyclonal antibody.
Lane 1: EDG1 transfected lysate(42.80 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human EDG1 protein.
Immunogen
EDG1 (NP_001391.2, 1 a.a. ~ 382 a.a) full-length human protein.
Sequence
MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKLTSVVFILICCFIILENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLREGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNNFRLFLLISACWVISLILGGLPIMGWNCISALSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKNISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKVKTCDILFRAEYFLVLAVLNSGTNPIIYTLTNKEMRRAFIRIMSCCKCPSGDSAGKFKRPIIAGMEFSRSKSDNSSHPQKDEGDNPETIMSSGNVNSSS
Host
Rabbit
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (94); Rat (94)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
EDG1 MaxPab rabbit polyclonal antibody. Western Blot analysis of EDG1 expression in mouse lung.Western Blot (Transfected lysate)
Western Blot analysis of S1PR1 expression in transfected 293T cell line (H00001901-T01) by S1PR1 MaxPab polyclonal antibody.
Lane 1: EDG1 transfected lysate(42.80 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — S1PR1
Entrez GeneID
1901GeneBank Accession#
NM_001400Protein Accession#
NP_001391.2Gene Name
S1PR1
Gene Alias
CHEDG1, D1S3362, ECGF1, EDG-1, EDG1, FLJ58121, S1P1
Gene Description
sphingosine-1-phosphate receptor 1
Omim ID
601974Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is structurally similar to G protein-coupled receptors and is highly expressed in endothelial cells. It binds the ligand sphingosine-1-phosphate with high affinity and high specificity, and suggested to be involved in the processes that regulate the differentiation of endothelial cells. Activation of this receptor induces cell-cell adhesion. [provided by RefSeq
Other Designations
G protein-coupled sphingolipid receptor|OTTHUMP00000012525|endothelial differentiation, sphingolipid G-protein-coupled receptor, 1|sphingosine 1-phosphate receptor EDG1
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com