DGKA purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human DGKA protein.
Immunogen
DGKA (NP_001336.2, 1 a.a. ~ 735 a.a) full-length human protein.
Sequence
MAKERGLISPSDFAQLQKYMEYSTKKVSDVLKLFEDGEMAKYVQGDAIGYEGFQQFLKIYLEVDNVPRHLSLALFQSFETGHCLNETNVTKDVVCLNDVSCYFSLLEGGRPEDKLEFTFKLYDTDRNGILDSSEVDKIILQMMRVAEYLDWDVSELRPILQEMMKEIDYDGSGSVSQAEWVRAGATTVPLLVLLGLEMTLKDDGQHMWRPKRFPRPVYCNLCESSIGLGKQGLSCNLCKYTVHDQCAMKALPCEVSTYAKSRKDIGVQSHVWVRGGCESGRCDRCQKKIRIYHSLTGLHCVWCHLEIHDDCLQAVGHECDCGLLRDHILPPSSIYPSVLASGPDRKNSKTSQKTMDDLNLSTSEALRIDPVPNTHPLLVFVNPKSGGKQGQRVLWKFQYILNPRQVFNLLKDGPEIGLRLFKDVPDSRILVCGGDGTVGWILETIDKANLPVLPPVAVLPLGTGNDLARCLRWGGGYEGQNLAKILKDLEMSKVVHMDRWSVEVIPQQTEEKSDPVPFQIINNYFSIGVDASIAHRFHIMREKYPEKFNSRMKNKLWYFEFATSESIFSTCKKLEESLTVEICGKPLDLSNLSLEGIAVLNIPSMHGGSNLWGDTRRPHGDIYGINQALGATAKVITDPDILKTCVPDLSDKRLEVVGLEGAIEMGQIYTKLKNAGRRLAKCSEITFHTTKTLPMQIDGEPWMQTPCTIKITHKNQMPMLMGPPPRSTNFFGFLS
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
DGKA MaxPab polyclonal antibody. Western Blot analysis of DGKA expression in human spleen.Western Blot (Transfected lysate)
Western Blot analysis of DGKA expression in transfected 293T cell line (H00001606-T01) by DGKA MaxPab polyclonal antibody.
Lane 1: DGKA transfected lysate(80.85 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to DGKA on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — DGKA
Entrez GeneID
1606GeneBank Accession#
NM_001345Protein Accession#
NP_001336.2Gene Name
DGKA
Gene Alias
DAGK, DAGK1, DGK-alpha, MGC12821, MGC42356
Gene Description
diacylglycerol kinase, alpha 80kDa
Omim ID
125855Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene belongs to the eukaryotic diacylglycerol kinase family. It acts as a modulator that competes with protein kinase C for the second messenger diacylglycerol in intracellular signaling pathways. It also plays an important role in the resynthesis of phosphatidylinositols and phosphorylating diacylglycerol to phosphatidic acid. Alternative splicing occurs at this locus and four transcript variants encoding the same protein have been identified. [provided by RefSeq
Other Designations
diacylglycerol kinase alpha|diacylglycerol kinase, alpha (80kD)
-
Interactome
-
Pathway
-
Publication Reference
-
Co-targeting FAK and Gli1 inhibits the tumor-associated macrophages-released CCL22-mediated esophageal squamous cell carcinoma malignancy.
Jie Chen, Yanmeng Zhu, Di Zhao, Lingyuan Zhang, Jing Zhang, Yuanfan Xiao, Qingnan Wu, Yan Wang, Qimin Zhan.
MedComm 2023 Oct; 4(6):e381.
Application:WB, Human, KYSE410, KYSE510 (esophageal squamous cell carcinoma, ESCC cells).
-
Chrysin serves as a novel inhibitor of DGK α/FAK interaction to suppress the malignancy of esophageal squamous cell carcinoma (ESCC).
Jie Chen, Yan Wang, Di Zhao, Lingyuan Zhang, Weimin Zhang, Jiawen Fan, Jinting Li, Qimin Zhan.
Acta Pharmaceutica Sinica. B 2021 Jan; 11(1):143.
Application:IF, WB-Ce, WB-Tr, Human, KYSE30, KYSE150, KYSE410 cells.
-
Diacylglycerol kinase-ζ regulates mTORC1 and lipogenic metabolism in cancer cells through SREBP-1.
Torres-Ayuso P, Tello-Lafoz M, Merida I, Avila-Flores A.
Oncogenesis 2015 Aug; 4:e164.
Application:WB, Human, SW480 cells.
-
Identification of candidate genes encoding an LDL-C QTL in baboons.
Karere GM, Glenn JP, Birnbaum S, Rainwater DL, Mahaney MC, Vandeberg JL, Cox LA.
Journal of Lipid Research 2013 Jul; 54(7):1776.
Application:WB-Ti, Baboon, Liver.
-
Diacylglycerol kinase ? regulates the formation and polarisation of mature multivesicular bodies involved in the secretion of Fas ligand-containing exosomes in T lymphocytes.
Alonso R, Mazzeo C, Rodriguez MC, Marsh M, Fraile-Ramos A, Calvo V, Avila-Flores A, Merida I, Izquierdo M.
Cell Death and Differentiation 2011 Jul; 18(7):1161.
Application:IF, WB, Human, Jurkat, J-HM1-2.2 cells.
-
Co-targeting FAK and Gli1 inhibits the tumor-associated macrophages-released CCL22-mediated esophageal squamous cell carcinoma malignancy.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com