CSNK2A1 monoclonal antibody (M01), clone 3D9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
CSNK2A1 monoclonal antibody (M01), clone 3D9 Western Blot analysis of CSNK2A1 expression in Hela S3 NE ( Cat # L013V3 ).
Western Blot (Transfected lysate)
Western Blot analysis of CSNK2A1 expression in transfected 293T cell line by CSNK2A1 monoclonal antibody (M01), clone 3D9.
Lane 1: CSNK2A1 transfected lysate(45.1 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CSNK2A1 is approximately 3ng/ml as a capture antibody.
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between TP53 and CSNK2A1. HeLa cells were stained with anti-TP53 rabbit purified polyclonal 1:1200 and anti-CSNK2A1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
Immunofluorescence
Immunofluorescence of monoclonal antibody to CSNK2A1 on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (36.63 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CSNK2A1.
Immunogen
CSNK2A1 (AAH11668, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MSGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINITNNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADI
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (100); Rat (100)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CSNK2A1 monoclonal antibody (M01), clone 3D9 Western Blot analysis of CSNK2A1 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Transfected lysate)
Western Blot analysis of CSNK2A1 expression in transfected 293T cell line by CSNK2A1 monoclonal antibody (M01), clone 3D9.
Lane 1: CSNK2A1 transfected lysate(45.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CSNK2A1 is approximately 3ng/ml as a capture antibody.ELISA
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between TP53 and CSNK2A1. HeLa cells were stained with anti-TP53 rabbit purified polyclonal 1:1200 and anti-CSNK2A1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).Immunofluorescence
Immunofluorescence of monoclonal antibody to CSNK2A1 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — CSNK2A1
Entrez GeneID
1457GeneBank Accession#
BC011668Protein Accession#
AAH11668Gene Name
CSNK2A1
Gene Alias
CK2A1, CKII
Gene Description
casein kinase 2, alpha 1 polypeptide
Omim ID
115440Gene Ontology
HyperlinkGene Summary
Casein kinase II is a serine/threonine protein kinase that phosphorylates acidic proteins such as casein. The kinase exists as a tetramer and is composed of an alpha, an alpha-prime, and two beta subunits. The alpha subunits contain the catalytic activity while the beta subunits undergo autophosphorylation. The protein encoded by this gene represents the alpha subunit. While this gene is found on chromosome 20, a related transcribed pseudogene is found on chromosome 11. Three transcript variants encoding two different proteins have been found for this gene. [provided by RefSeq
Other Designations
CK2 catalytic subunit alpha|OTTHUMP00000029925|OTTHUMP00000029926|casein kinase II alpha 1 subunit|casein kinase II alpha subunit|protein kinase CK2
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
CK2 Inhibitors Enhance the Radiosensitivity of Human Non-Small Cell Lung Cancer Cells Through Inhibition of Stat3 Activation.
Lin YC, Hung MS, Lin CK, Li JM, Lee KD, Li YC, Chen MF, Chen JK, Yang CT.
Cancer Biotherapy & Radiopharmaceuticals 2011 Jun; 26(3):381.
Application：WB-Ce, Human, A549, H460, H1650, H1975, H1703, H838 cells.
-
CK2 Inhibitors Enhance the Radiosensitivity of Human Non-Small Cell Lung Cancer Cells Through Inhibition of Stat3 Activation.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com