CEBPE purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human CEBPE protein.
Immunogen
CEBPE (NP_001796.2, 1 a.a. ~ 281 a.a) full-length human protein.
Sequence
MSHGTYYECEPRGGQQPLEFSGGRAGPGELGDMCEHEASIDLSAYIESGEEQLLSDLFAVKPAPEARGLKGPGTPAFPHYLPPDPRPFAYPPHTFGPDRKALGPGIYSSPGSYDPRAVAVKEEPRGPEGSRAASRGSYNPLQYQVAHCGQTAMHLPPTLAAPGQPLRVLKAPLATAAPPCSPLLKAPSPAGPLHKGKKAVNKDSLEYRLRRERNNIAVRKSRDKAKRRILETQQKVLEYMAENERLRSRVEQLTQELDTLRNLFRQIPEAANLIKGVGGCS
Host
Rabbit
Reactivity
Human, Mouse
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
CEBPE MaxPab rabbit polyclonal antibody. Western Blot analysis of CEBPE expression in mouse liver.Western Blot (Transfected lysate)
Western Blot analysis of CEBPE expression in transfected 293T cell line by CEBPE MaxPab rabbit polyclonal antibody.
Lane 1: CEBPE transfected lysate(30.60 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — CEBPE
Entrez GeneID
1053GeneBank Accession#
NM_001805.2Protein Accession#
NP_001796.2Gene Name
CEBPE
Gene Alias
C/EBP-epsilon, CRP1
Gene Description
CCAAT/enhancer binding protein (C/EBP), epsilon
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a bZIP transcription factor which can bind as a homodimer to certain DNA regulatory regions. It can also form heterodimers with the related protein CEBP-delta. The encoded protein may be essential for terminal differentiation and functional maturation of committed granulocyte progenitor cells. Mutations in this gene have been associated with Specific Granule Deficiency, a rare congenital disorder. Multiple variants of this gene have been described, but the full-length nature of only one has been determined. [provided by RefSeq
Other Designations
CCAAT/enhancer binding protein epsilon
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com