CDKN2C purified MaxPab mouse polyclonal antibody (B02P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of CDKN2C expression in transfected 293T cell line (H00001031-T02) by CDKN2C MaxPab polyclonal antibody.
Lane 1: CDKN2C transfected lysate(18.48 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to CDKN2C on HeLa cell. [antibody concentration 10 ug/ml]
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human CDKN2C protein.
Immunogen
CDKN2C (NP_001253.1, 1 a.a. ~ 168 a.a) full-length human protein.
Sequence
MAEPWGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRGANPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVEFLVKHTASNVGHRNHKGDTACDLARLYGRNEVVSLMQANGAGGATNLQ
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of CDKN2C expression in transfected 293T cell line (H00001031-T02) by CDKN2C MaxPab polyclonal antibody.
Lane 1: CDKN2C transfected lysate(18.48 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to CDKN2C on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — CDKN2C
Entrez GeneID
1031GeneBank Accession#
NM_001262.2Protein Accession#
NP_001253.1Gene Name
CDKN2C
Gene Alias
INK4C, p18, p18-INK4C
Gene Description
cyclin-dependent kinase inhibitor 2C (p18, inhibits CDK4)
Omim ID
603369Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the INK4 family of cyclin-dependent kinase inhibitors. This protein has been shown to interact with CDK4 or CDK6, and prevent the activation of the CDK kinases, thus function as a cell growth regulator that controls cell cycle G1 progression. Ectopic expression of this gene was shown to suppress the growth of human cells in a manner that appears to correlate with the presence of a wild-type RB1 function. Studies in the knockout mice suggested the roles of this gene in regulating spermatogenesis, as well as in suppressing tumorigenesis. Two alternatively spliced transcript variants of this gene, which encode an identical protein, have been reported. [provided by RefSeq
Other Designations
CDK6 inhibitor p18|OTTHUMP00000009730|OTTHUMP00000009731|OTTHUMP00000046546|cyclin-dependent inhibitor|cyclin-dependent kinase 4 inhibitor C|cyclin-dependent kinase 6 inhibitor p18|cyclin-dependent kinase inhibitor 2C
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com