CDH18 monoclonal antibody (M01), clone 6F7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
CDH18 monoclonal antibody (M01), clone 6F7 Western Blot analysis of CDH18 expression in HeLa ( Cat # L013V1 ).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to CDH18 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CDH18 is approximately 0.1ng/ml as a capture antibody.
Western Blot detection against Immunogen (37.84 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CDH18.
Immunogen
CDH18 (NP_004925, 467 a.a. ~ 576 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
DLLSHVTVGIRVLDVNDNPPELAREYDIIVCENSKPGQVIHTISATDKDDFANGPRFNFFLDERLPVNPNFTLKDNEDNTASILTRRRRFSRTVQDVYYLPIMISDGGIP
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (95)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CDH18 monoclonal antibody (M01), clone 6F7 Western Blot analysis of CDH18 expression in HeLa ( Cat # L013V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to CDH18 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CDH18 is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — CDH18
Entrez GeneID
1016GeneBank Accession#
NM_004934Protein Accession#
NP_004925Gene Name
CDH18
Gene Alias
CDH14, CDH14L, CDH24, EY-CADHERIN
Gene Description
cadherin 18, type 2
Omim ID
603019Gene Ontology
HyperlinkGene Summary
This gene encodes a type II classical cadherin from the cadherin superfamily of integral membrane proteins that mediate calcium-dependent cell-cell adhesion. Mature cadherin proteins are composed of a large N-terminal extracellular domain, a single membrane-spanning domain, and a small, highly conserved C-terminal cytoplasmic domain. Type II (atypical) cadherins are defined based on their lack of a HAV cell adhesion recognition sequence specific to type I cadherins. This particular cadherin is expressed specifically in the central nervous system and is putatively involved in synaptic adhesion, axon outgrowth and guidance. [provided by RefSeq
Other Designations
OTTHUMP00000115690|cadherin-14|cadherin-18|cadherin-like 24
-
Interactome
-
Disease
-
Publication Reference
-
PDLIM7 and CDH18 regulate the turnover of MDM2 during CDK4/6 inhibitor therapy-induced senescence.
Klein ME, Dickson MA, Antonescu C, Qin LX, Dooley SJ, Barlas A, Manova K, Schwartz GK, Crago AM, Singer S, Koff A, Tap WD.
Oncogene 2018 May; [Epub].
Application：IHC-P, WB-Ce, Human, LS8817, LS141, LS0082, H1975, LS8107, LS8313, H358 cells, Liposarcomas.
-
PDLIM7 and CDH18 regulate the turnover of MDM2 during CDK4/6 inhibitor therapy-induced senescence.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com