PRDM1 monoclonal antibody (M01), clone 2B10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PRDM1.
Immunogen
PRDM1 (NP_001189, 1 a.a. ~ 109 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MKMDMEDADMTLWTEAEFEEKCTYIVNDHPWDSGADGGTSVQAEASLPRNLLFKYATNSEEVIGVMSKEYIPKGTRFGPLIGEIYTNDTVPKNANRKYFWRIYSRGELH
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.73 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
PRDM1 monoclonal antibody (M01), clone 2B10. Western Blot analysis of PRDM1 expression in human tongue.Western Blot (Tissue lysate)
PRDM1 monoclonal antibody (M01), clone 2B10. Western Blot analysis of PRDM1 expression in human spleen.Western Blot (Transfected lysate)
Western Blot analysis of PRDM1 expression in transfected 293T cell line by PRDM1 monoclonal antibody (M01), clone 2B10.
Lane 1: PRDM1 transfected lysate(88 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PRDM1 is approximately 0.3ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of PRDM1 over-expressed 293 cell line, cotransfected with PRDM1 Validated Chimera RNAi ( Cat # H00000639-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with PRDM1 monoclonal antibody (M01), clone 2B10 (Cat # H00000639-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — PRDM1
Entrez GeneID
639GeneBank Accession#
NM_001198Protein Accession#
NP_001189Gene Name
PRDM1
Gene Alias
BLIMP1, MGC118922, MGC118923, MGC118924, MGC118925, PRDI-BF1
Gene Description
PR domain containing 1, with ZNF domain
Omim ID
603423Gene Ontology
HyperlinkGene Summary
This gene encodes a protein that acts as a repressor of beta-interferon gene expression. The protein binds specifically to the PRDI (positive regulatory domain I element) of the beta-IFN gene promoter. Transcription of this gene increases upon virus induction. Two alternatively spliced transcript variants that encode different isoforms have been reported. [provided by RefSeq
Other Designations
B-lymphocyte-induced maturation protein 1|OTTHUMP00000016918|PR-domain zinc finger protein 1|PRDI-binding factor-1|beta-interferon gene positive-regulatory domain I binding factor|positive regulatory domain I-binding factor 1
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com